DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Bolliger MF., Martinelli DC., Südhof TC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bolliger MF., Martinelli DC., Südhof TC. DIP original experiment: DIP-249672X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Bolliger MF., Martinelli DC., Südhof TC. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bolliger MF., Martinelli DC., Südhof TC. DIP original experiment: DIP-249673X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Bolliger MF., Martinelli DC., Südhof TC. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bolliger MF., Martinelli DC., Südhof TC. DIP original experiment: DIP-249671X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Bolliger MF., Martinelli DC., Südhof TC. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Bolliger MF., Martinelli DC., Südhof TC. DIP original experiment: DIP-249670X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx The cell-adhesion G protein-coupled receptor BAI3 is a high-affinity receptor for C1q-like proteins. c1ql2_mouse Complement C1q-like protein 2 C1q and tumor necrosis factor-related protein 10 C1ql2 C1qtnf10 Ctrp10 protein protein mouse Mus musculus Mouse MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYSVAPAGGPAGAKAPPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGGVGVVSGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD DIP protein Q8CFR0 original sequence version: 73 DIP protein Q8CFR0 original sequence version: 92 8FF89EC1C7420415 agrb3_human Adhesion G protein-coupled receptor B3 ADGRB3 BAI3 Brain-specific angiogenesis inhibitor 3 KIAA0550 protein protein human Homo sapiens Human MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYDKNFIQIRRVFPTNFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLKSENGRTESCGIMYTKCTCPQHLGEWGIDDQSLILLNNVVLPLNEQTEGCLTQELQTTQVCNLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQWSTCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGTQQRSRQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGGWERRIRTCQGAVITGQQCEGTGEEVRRCNEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTKTLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNYTVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYAALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVLTEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCGVVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVLHKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPMSMNELSNPCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNNQPSMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLEQHLAPQEHMQNLPFEPRTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQELNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRPAEWEKCLNLPLDVQEGDFQTEV DIP protein O60242 original sequence version: 116 D22D0A5CF59E811F c1ql3_mouse Complement C1q-like protein 3 C1ql3 C1ql Ctrp13 C1q and tumor necrosis factor-related protein 13 Gliacolin protein protein mouse Mus musculus Mouse MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD DIP protein Q9ESN4 original sequence version: 87 DIP protein Q9ESN4 original sequence version: 108 adgrb3-c1ql2-1 4 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait Region 20-799 Region 20-799 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association adgrb3-c1ql3-1 1 7 unspecified role unspecified role prey prey Region 21-255 Region 21-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 6 unspecified role unspecified role bait bait Region 20-799 Region 20-799 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human direct interaction direct interaction c1ql3-adgrb3-1 3 7 unspecified role unspecified role bait bait Region 21-255 Region 21-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role prey prey Region 20-799 Region 20-799 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human direct interaction direct interaction c1ql3-adgrb3-2 2 7 unspecified role unspecified role bait bait Region 119-255 Region 119-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 287-509 Region 287-509 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction