DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218413X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218428X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218425X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218415X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218419X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218427X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218429X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218423X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218426X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight silver stain molecular weight estimation by silver staining weight silver stain Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218432X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218424X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218417X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218418X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218430X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218422X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218416X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218412X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218411X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218414X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218420X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218431X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. Nature structural & molecular biology 2011 imex curation Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Buschhorn BA., Petzold G., Galova M., Dube P., Kraft C., Herzog F., Stark H., Peters JM. DIP original experiment: DIP-218421X Nature structural & molecular biology 2011 IMEx Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1. cdc23_human Cell division cycle protein 23 homolog CDC23 ANAPC8 Anaphase-promoting complex subunit 8 Cyclosome subunit 8 protein protein human Homo sapiens Human MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP DIP protein Q9UJX2 original sequence version: 103 DIP protein Q9UJX2 original sequence version: 131 DIP protein Q9UJX2 original sequence version: 135 DIP protein Q9UJX2 original sequence version: 145 DIP protein Q9UJX2 original sequence version: 154 358F2B8745DB9D32 cdc27_yeast Anaphase-promoting complex subunit CDC27 APC3 CDC27 SNB1 YBL084C YBL0718 Cell division control protein 27 Anaphase-promoting complex subunit 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAVNPELAPFTLSRGIPSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSILDKSSVYWSDAVYLYALSLFLNKSYHTAFQISKEFKEYHLGIAYIFGRCALQLSQGVNEAILTLLSIINVFSSNSSNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEALAINPYLWESYEAICKMRATVDLKRVFFDIAGKKSNSHNNNAASSFPSTSLSHFEPRSQPSLYSKTNKNGNNNINNNVNTLFQSSNSPPSTSASSFSSIQHFSRSQQQQANTSIRTCQNKNTQTPKNPAINSKTSSALPNNISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNNDRNHQNNNNNNNNNNNNNNNNNNNNNNNNIINKTTFKTPRNLYSSTGRLTTSKKNPRSLIISNSILTSDYSITLPEIMYNFALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQVIIDELQKCHMQE A1ECA067AF8784E3 A1ECA067AF8784E3 apc1_human Anaphase-promoting complex subunit 1 ANAPC1 TSG24 Cyclosome subunit 1 Testis-specific gene 24 protein Mitotic checkpoint regulator protein protein human Homo sapiens Human MSNFYEERTTMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGSLQEVTIHEKQKESWQLRKGVSEIGEDVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVDSPVQQALWCDFIISQDKSEKAYSSNEVEKCICILQSSCINMHSIEGKDYIASLPFQVANVWPTKYGLLFERSASSHEVPPGSPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVVDHAMKIVFLNTDPSIVMTYDAVQNVHSVWTLRRVKSEEENVVLKFSEQGGTPQNVATSSSLTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGVHSFSGVQRFNISSHNQSPKRHSISHSPNSNSNGSFLAPETEPIVPELCIDHLWTETITNIREKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIPAKDAAPVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKPLSKLLGSLDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVHNRVTLELSNGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLFVTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVESHLLNRSLCLSPSEASQMKDEDFSQNLSLDSSTLLFTHIPAIFFVLHLVYEELKLNTLMGEGICSLVELLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDPGQTGFMHHPSFFTSEPPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESLVSDESSQYLTRITIAPQKLQVEQEENRFSFRHSTSVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIYHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMNHEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMALPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGHEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLVYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLNVPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNNRSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSISLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLSAPNASVTGPHNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHMALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM DIP protein Q9H1A4 original sequence version: 85 DIP protein Q9H1A4 original sequence version: 119 DIP protein Q9H1A4 original sequence version: 128 DIP protein Q9H1A4 original sequence version: 137 E08B1FE3FC28917E q13042-1 Cell division cycle protein 16 homolog CDC16 ANAPC6 Anaphase-promoting complex subunit 6 CDC16 homolog Cyclosome subunit 6 protein protein human Homo sapiens Human MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST DIP protein Q13042-1 original sequence version: 94 DIP protein Q13042 original sequence version: 99 DIP protein Q13042 original sequence version: 133 DIP protein Q13042 original sequence version: 143 DIP protein Q13042 original sequence version: 152 fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR DIP protein Q9UM11 original sequence version: 100 DIP protein Q9UM11 original sequence version: 131 DIP protein Q9UM11 original sequence version: 136 DIP protein Q9UM11 original sequence version: 145 F6C8FDAF81D8103A cdc23_yeast Anaphase-promoting complex subunit CDC23 YHR166C CDC23 Cell division control protein 23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDDSQDKIIHDIRIQLRKAATELSRWKLYGSSKWAAEALAGLAEAIDVDQTHSLADESPLRNKQGVPKQMFEIPQNGFGLSETEYDLYLLGSTLFDAKEFDRCVFFLKDVTNPYLKFLKLYSKFLSWDKKSQESMENILTTGKFTDEMYRANKDGDGSGNEDINQSGHQRANLKMVSNEHESQSNISSILKEINTFLESYEIKIDDDEADLGLALLYYLRGVILKQEKNISKAMSSFLKSLSCYSFNWSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIKFFKLKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLYEELEDLQECKKFMMKCVDVEELLEGIVTDETVKARLWLAIFEIKAGNYQLAYDYAMGVSSGTSQEIEEARMLARECRRHM 3C96FE2BC8097118 3C96FE2BC8097118 apc11_yeast Anaphase-promoting complex subunit 11 D2900 YDL008W APC11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 99F8E8C6BC841934 99F8E8C6BC841934 apc9_yeast Anaphase-promoting complex subunit 9 APC9 YLR102C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNQNGDKNEGKLFQLPSLPPWKTPRFNKANFNNFTTPLRKRSTRVINDDSMPITGEVLEERTADDLYGINMDVDEVDYLNTLSHIEEEKQYDYSPFCERNTLRESRIDSFLKAERAAHCLVFHKVGHLDGIDSYRPDIDIMCGEEANKYDSANPEGNGSMLLESVPGCNKEDLERLSRREFVTNSKPNMRRLDDIINHETNALKSFWNDSGLVNSLQSHHLHEEYLLLQEELKNVYKIKCHDRVPIESLRDKCRRHYSNEDSSFL 63423CC7CDFF47B2 63423CC7CDFF47B2 apc5_yeast Anaphase-promoting complex subunit 5 APC5 RMC1 YOR249C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKDNSNLRSSSIVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEKNCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVFKHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGTLISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQSGLVFDLLDTLSLNDATKFPLIFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAINSFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDANIFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNVPSQNFDLFQSLVSYEVKFWKELGYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLELDYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLSDVGIRSLPKIIKLIDEYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEFPFVRKKTDELLESLSVEEDRDVQMT 59310B47D5A1865F 59310B47D5A1865F mnd2_yeast Anaphase-promoting complex subunit MND2 YIR025W MND2 Meiotic nuclear division protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKKSRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFKPIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDSKVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERRARQQRGQD D41276561E6ED509 D41276561E6ED509 hsl1_yeast Probable serine/threonine-protein kinase HSL1 YKL453 YKL101W HSL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGHVSKTSHVPKGRPSSLAKKAAKRAMAKVNSNPKRASGHLERVVQSVNDATKRLSQPDSTVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSSSENKKSATESSVNEPRIEYASKTANNTGLRSENNDVKTLHSLEIHSEDTSTVNQNNAITGVNTEINAPVLAQKSQFSINTLSQPESDKAEAEAVTLPPAIPIFNASSSRIFRNSYTSISSRSRRSLRLSNSRLSLSASTSRETVHDNEMPLPQLPKSPSRYSLSRRAIHASPSTKSIHKSLSRKNIAATVAARRTLQNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDSDFEILCDQILFGNALDRILEEEEDNEKERDTQRQRQNDTKSSADTFTISGVSTNKENEGPEYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKPKRAALSDITNSFNKMNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQHQELRVNSLPNDQGKPSLSLDPRRNISQPVNSKVESLLQGLKFKKEPASHWTHERGSLFMSEHVEDEKPVKASDVSIESSYVPLTTVATSSRDPSVLAESSTIQKPMLSLPSSFLNTSMTFKNLSQILADDGDDKHLSVPQNQSRSVAMSHPLRKQSAKISLTPRSNLNANLSVKRNQGSPGSYLSNDLDGISDMTFAMEIPTNTFTAQAIQLMNNDTDNNKINTSPKASSFTKEKVIKSAAYISKEKEPDNSDTNYIPDYTIPNTYDEKAINIFEDAPSDEGSLNTSSSESDSRASVHRKAVSIDTMATTNVLTPATNVRVSLYWNNNSSGIPRETTEEILSKLRLSPENPSNTHMQKRFSSTRGSRDSNALGISQSLQSMFKDLEEDQDGHTSQADILESSMSYSKRRPSEESVNPKQRVTMLFDEEEEESKKVGGGKIKEEHTKLDNKISEESSQLVLPVVEKKENANNTENNYSKIPKPSTIKVTKDTAMESNTQTHTKKPILKSVQNVEVEEAPSSDKKNWFVKLFQNFSSHNNATKASKNHVTNISFDDAHMLTLNEFNKNSIDYQLKNLDHKFGRKVVEYDCKFVKGNFKFKIKITSTPNASTVITVKKRSKHSNTSSNKAFEKFNDDVERVIRNAGRS 803F84F7574304CD 803F84F7574304CD cdca5_human Sororin Cell division cycle-associated protein 5 p35 CDCA5 protein protein human Homo sapiens Human MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE DIP protein Q96FF9 original sequence version: 69 DIP protein Q96FF9 original sequence version: 98 DIP protein Q96FF9 original sequence version: 82 A4CD6768D3464040 pttg1_human Securin EAP1 PTTG TUTR1 Pituitary tumor-transforming gene 1 protein Esp1-associated protein PTTG1 protein protein human Homo sapiens Human MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI DIP protein O95997 original sequence version: 85 5F4740619AB8856F cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA apc10_human Anaphase-promoting complex subunit 10 ANAPC10 APC10 Cyclosome subunit 10 protein protein human Homo sapiens Human MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR DIP protein Q9UM13 original sequence version: 143 DIP protein Q9UM13 original sequence version: 83 DIP protein Q9UM13 original sequence version: 111 DIP protein Q9UM13 original sequence version: 115 DIP protein Q9UM13 original sequence version: 124 DIP protein Q9UM13 original sequence version: 133 ACA7F245B3861FF5 apc7_human Anaphase-promoting complex subunit 7 ANAPC7 APC7 Cyclosome subunit 7 protein protein human Homo sapiens Human MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ DIP protein Q9UJX3 original sequence version: 98 DIP protein Q9UJX3 original sequence version: 133 DIP protein Q9UJX3 original sequence version: 143 DIP protein Q9UJX3 original sequence version: 152 D187A1D9DA41DE2C anc2_human Anaphase-promoting complex subunit 2 ANAPC2 APC2 KIAA1406 Cyclosome subunit 2 protein protein human Homo sapiens Human MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS DIP protein Q9UJX6 original sequence version: 116 DIP protein Q9UJX6 original sequence version: 91 DIP protein Q9UJX6 original sequence version: 123 DIP protein Q9UJX6 original sequence version: 128 DIP protein Q9UJX6 original sequence version: 138 DIP protein Q9UJX6 original sequence version: 148 94A2B1D015805573 apc10_yeast Anaphase-promoting complex subunit DOC1 Destruction of cyclin B protein 1 DOC1 APC10 YGL240W HRC283 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILR F3C58B1BB986442D F3C58B1BB986442D apc2_yeast Anaphase-promoting complex subunit 2 APC2 RSI1 YLR127C L3105 L3108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVKNGHKNS E559A0E28C784DE2 E559A0E28C784DE2 apc4_human Anaphase-promoting complex subunit 4 APC4 Cyclosome subunit 4 ANAPC4 protein protein human Homo sapiens Human MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS DIP protein Q9UJX5 original sequence version: 78 DIP protein Q9UJX5 original sequence version: 115 DIP protein Q9UJX5 original sequence version: 120 DIP protein Q9UJX5 original sequence version: 124 DIP protein Q9UJX5 original sequence version: 133 80362CC8D8B2063F apc1_yeast Anaphase-promoting complex subunit 1 APC1 N1677 YNL172W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIEDQCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWYANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASGNKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTGLDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFALPSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYLNQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHFCKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSEGQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYITSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQEYKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATAAMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCPFISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYPLGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYMLCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKLNAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVGWGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGLRISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISIGLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRHKRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDDLPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNNFGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTISVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQVTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLALGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDISTGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDYSASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNTTSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWYKSFGPHDE 33D32EC47CA40E61 33D32EC47CA40E61 apc4_yeast Anaphase-promoting complex subunit 4 APC4 YDR118W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRGENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQNV CC7E3818FFD6AF25 CC7E3818FFD6AF25 cdc16_yeast Anaphase-promoting complex subunit CDC16 CDC16 YKL022C Cell division control protein 16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELE A096B34441083488 A096B34441083488 apc5_human Anaphase-promoting complex subunit 5 ANAPC5 APC5 Cyclosome subunit 5 protein protein human Homo sapiens Human MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL DIP protein Q9UJX4 original sequence version: 88 DIP protein Q9UJX4 original sequence version: 126 DIP protein Q9UJX4 original sequence version: 136 DIP protein Q9UJX4 original sequence version: 145 174F68EAB44760EB cdc16-doc1-1 9 45 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association cdc16-apc1-13 18 40 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association cdc16-apc11-1 4 45 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association apc1-doc1-1 14 43 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association apc4-apc5-1 13 31 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc16-doc1-2 3 45 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association cdc16-apc1-14 16 45 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association apc1-doc1-2 7 43 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association cdc27-cdc16-2 15 34 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role bait bait human Homo sapiens Human association association apc4-apc5-2 5 40 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association apc1-doc1-3 2 43 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association apc1-apc1-1 1 43 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc16-apc1-15 12 45 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey RFP-tag RFP-tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association cdc16-doc1-3 11 45 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association cdc27-cdc16-3 20 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role prey prey Region 667-872 Region 667-872 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 36 unspecified role unspecified role bait bait human Homo sapiens Human association association hsl1-anapc1-1 10 37 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 38 unspecified role unspecified role prey prey human Homo sapiens Human 46 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role prey prey human Homo sapiens Human 39 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association cdc27-cdc16-4 8 35 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role bait bait human Homo sapiens Human association association apc1-doc1-4 6 43 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association apc1-apc1-2 19 43 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc27-cdc16-5 22 27 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 26 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role bait bait human Homo sapiens Human association association apc1-apc11-1 17 40 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc27-doc1-1 21 24 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role CL-tag CL-tag cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association