DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. DIP original experiment: DIP-249069X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. DIP original experiment: DIP-249070X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Karagöz GE., Duarte AM., Ippel H., Uetrecht C., Sinnige T., van Rosmalen M., Hausmann J., Heck AJ., Boelens R., Rüdiger SG. DIP original experiment: DIP-249068X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx N-terminal domain of human Hsp90 triggers binding to the cochaperone p23. tebp_human Prostaglandin E synthase 3 Cytosolic prostaglandin E2 synthase Telomerase-binding protein p23 Progesterone receptor complex p23 PTGES3 P23 TEBP Hsp90 co-chaperone protein protein human Homo sapiens Human MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE DIP protein Q15185 original sequence version: 98 DIP protein Q15185 original sequence version: 117 23538BB9D7AFD73F hs90b_human Heat shock protein HSP 90-beta HSP90AB1 HSP90B HSPC2 HSPCB Heat shock 84 kDa protein protein human Homo sapiens Human MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRMEEVD DIP protein P08238 original sequence version: 91 DIP protein P08238 original sequence version: 149 DIP protein P08238 original sequence version: 165 DIP protein P08238 original sequence version: 167 DIP protein P08238 original sequence version: 210 DIP protein P08238 original sequence version: 187 A93118C214D03810 hsp90ab1-ptges3-1 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hsp90ab1-ptges3-2 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hsp90ab1-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction