DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220650X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220651X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220652X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220654X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220653X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. ompf_ecoli Outer membrane porin F ompF cmlB tolF coa cry Porin OmpF Outer membrane protein 1A Outer membrane protein IA Outer membrane protein B b0929 JW0912 Outer membrane protein F protein protein ecoli Escherichia coli (strain K12) MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF 3F0974D96DB65464 3F0974D96DB65464 cea9_ecolx Colicin-E9 col cei protein protein ecolx Escherichia coli MSGGDGRGHNTGAHSTSGNINGGPTGIGVSGGASDGSGWSSENNPWGGGSGSGIHWGGGSGRGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISASELSAAIAGIIAKLKKVNLKFTPFGVVLSSLIPSEIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNDSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLDKESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELHHDKPISQGGEVYDMDNIRVTTPKRHIDIHRGK DIP protein P09883 original sequence version: 99 DIP protein P09883 original sequence version: 76 DIP protein P09883 original sequence version: 81 DIP protein P09883 original sequence version: 84 DIP protein P09883 original sequence version: 86 47A71B57B45AFDD9 col-ompf-1 1 7 unspecified role unspecified role unspecified role unspecified role Region 2-18 Region 2-18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction col-ompf-2 5 7 unspecified role unspecified role unspecified role unspecified role Region 2-18 Region 2-18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 54-63 Region 54-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction col-ompf-3 2 7 unspecified role unspecified role unspecified role unspecified role Region 1-347 Region 1-347 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction col-ompf-4 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-347 Region 1-347 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 1-83 Region 1-83 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-8 Region 1-8 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ompf-2 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction