UniProt UniProt http://www.uniprot.org Cox25 teams up with Mss51, Ssc1, and Cox14 to regulate mitochondrial cytochrome c oxidase subunit 1 expression and assembly in Saccharomyces cerevisiae. Cox25 teams up with Mss51, Ssc1, and Cox14 to regulate mitochondrial cytochrome c oxidase subunit 1 expression and assembly in Saccharomyces cerevisiae. The Journal of biological chemistry 2011 imex curation Fontanesi F., Clemente P., Barrientos A. Additional details of constructs taken from PMID:15306853 as referenced in the text. abarrientos@med.miami.edu 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Fontanesi F., Clemente P., Barrientos A. Additional details of constructs taken from PMID:15306853 as referenced in the text. abarrientos@med.miami.edu Accepted 2018-JAN-04 AT 13:14 GMT AT 13:14 GMT by LIVIAP The Journal of biological chemistry 2011 imex curation Data was from 6B, not 6C - figure legend corrected. The 5A/B data was from 6D, where they've used a single Ab but used the molecular weight difference to differentiate the 2 proteins. We've always accepted that, when there is a clear difference. I have added a comment to say this is how it was done. cox5a_yeast Cytochrome c oxidase subunit 5A, mitochondrial COX5A YNL052W N2474 YNL2474W Cytochrome c oxidase polypeptide Va protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK 1B1F8A3FE12CF783 cox5b_yeast Cytochrome c oxidase subunit 5B, mitochondrial COX5B Cytochrome c oxidase polypeptide Vb YIL111W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPRRPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPKTMNREWQLKSDEYLKSKNANPWGGYSQVQSK 566B4E69631CBDE0 coa3_yeast Cytochrome c oxidase assembly factor 3, mitochondrial COA3 COX25 RRG10 Required for respiratory growth protein 10 YJL062W-A Cytochrome c oxidase protein 25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFADVPIPPIDPQELEALKKEYEAKKKA 41403CD21F898C18 mss51_yeast Protein MSS51, mitochondrial MSS51 YLR203C L8167.17 Mitochondrial splicing suppressor protein 51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ 6A55BF160FE1D7DE shy1_yeast Cytochrome oxidase assembly protein SHY1 SHY1 YGR112W G6150 SURF1-like protein SURF1 homolog of Yeast protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPNDDSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSFTPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWISEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMARSSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNTSKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLIVALRKAKRGGVVSQDQLMKEKLKHSRKYM 2C95E607B7507321 cox14_yeast Cytochrome c oxidase assembly protein COX14 COX14 YM4987.06C YML129C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQLQSPTAPPTE B26DEAE366707617 mss51-coa3-2 1 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Interaction observed in cox11-/- cells Fig. 6B cox14-coa3-1 1 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell association association Interaction observed in cox11-/- cells Fig. 6B mss51-coa3-1 1 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 6A Interaction observed in cox11-/- cells coa3-cox14-1 1 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell association association Fig. 6B, 6D COX5 (A/B not specified) was efficiently pulled down in SHY1-/- cells, but not in COX14-/- cells. The identification of COX5A/B in the complex was made by molecular weight difference using a common antibody