DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. Nature structural & molecular biology 2010 imex curation Hilf RJ., Bertozzi C., Zimmermann I., Reiter A., Trauner D., Dutzler R. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hilf RJ., Bertozzi C., Zimmermann I., Reiter A., Trauner D., Dutzler R. DIP original experiment: DIP-217724X Nature structural & molecular biology 2010 IMEx Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. Nature structural & molecular biology 2010 imex curation Hilf RJ., Bertozzi C., Zimmermann I., Reiter A., Trauner D., Dutzler R. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hilf RJ., Bertozzi C., Zimmermann I., Reiter A., Trauner D., Dutzler R. DIP original experiment: DIP-217725X Nature structural & molecular biology 2010 IMEx Structural basis of open channel block in a prokaryotic pentameric ligand-gated ion channel. glic_glovi Proton-gated ion channel glr4197 Ligand-gated ion channel GLIC glvI protein protein glovi Gloeobacter violaceus (strain PCC 7421) MFPTGWRPKLSESIAASRMLWQPMAAVAVVQIGLLWFSPPVWGQDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF DIP protein Q7NDN8 original sequence version: 68 DIP protein Q7NDN8 original sequence version: 70 DIP protein Q7NDN8 original sequence version: 85 DIP protein Q7NDN8 original sequence version: 86 DIP protein Q7NDN8 original sequence version: 57 DIP protein Q7NDN8 original sequence version: 59 6F9009F96172C025 glic-6 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction glic-7 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction