DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. Nature 2010 imex curation Chekeni FB., Elliott MR., Sandilos JK., Walk SF., Kinchen JM., Lazarowski ER., Armstrong AJ., Penuela S., Laird DW., Salvesen GS., Isakson BE., Bayliss DA., Ravichandran KS. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Chekeni FB., Elliott MR., Sandilos JK., Walk SF., Kinchen JM., Lazarowski ER., Armstrong AJ., Penuela S., Laird DW., Salvesen GS., Isakson BE., Bayliss DA., Ravichandran KS. DIP original experiment: DIP-219314X Nature 2010 IMEx Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. Nature 2010 imex curation Chekeni FB., Elliott MR., Sandilos JK., Walk SF., Kinchen JM., Lazarowski ER., Armstrong AJ., Penuela S., Laird DW., Salvesen GS., Isakson BE., Bayliss DA., Ravichandran KS. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Chekeni FB., Elliott MR., Sandilos JK., Walk SF., Kinchen JM., Lazarowski ER., Armstrong AJ., Penuela S., Laird DW., Salvesen GS., Isakson BE., Bayliss DA., Ravichandran KS. DIP original experiment: DIP-219313X Nature 2010 IMEx Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis. casp7_human Caspase-7 ICE-like apoptotic protease 3 Apoptotic protease Mch-3 CMH-1 CASP7 MCH3 protein protein human Homo sapiens Human MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ DIP protein P55210 original sequence version: 92 DIP protein P55210 original sequence version: 114 DIP protein P55210 original sequence version: 118 CD373EE54A232CA4 casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A panx1_human Pannexin-1 PANX1 MRS1 UNQ2529/PRO6028 protein protein human Homo sapiens Human MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC DIP protein Q96RD7 original sequence version: 78 mint Structural component of the gap junctions 368B48E0709424FB casp3-panx1-1 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role Q96RD7:p.[Asp164Ala;Asp167Ala;Asp376Ala;Asp379Ala] D164A/D167A/D376A/D379A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D164A/D167A/D376A/D379A'. Wed May 02 15:17:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp164ala,asp167ala,asp376ala,asp379ala' Tue Jun 30 19:39:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp164Ala;Asp167Ala;Asp376Ala;Asp379Ala]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage casp7-panx1-1 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role Q96RD7:p.[Asp164Ala;Asp167Ala;Asp376Ala;Asp379Ala] D164A/D167A/D376A/D379A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D164A/D167A/D376A/D379A'. Wed May 02 16:28:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp164ala,asp167ala,asp376ala,asp379ala' Tue Jun 30 18:11:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp164Ala;Asp167Ala;Asp376Ala;Asp379Ala]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 3 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage