DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220495X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220493X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220492X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220494X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220491X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Chong PA., Lin H., Wrana JL., Forman-Kay JD. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Chong PA., Lin H., Wrana JL., Forman-Kay JD. DIP original experiment: DIP-220496X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity. smuf2_human E3 ubiquitin-protein ligase SMURF2 SMURF2 SMAD ubiquitination regulatory factor 2 SMAD-specific E3 ubiquitin-protein ligase 2 HECT-type E3 ubiquitin transferase SMURF2 protein protein human Homo sapiens Human MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE DIP protein Q9HAU4 original sequence version: 112 DIP protein Q9HAU4 original sequence version: 123 DIP protein Q9HAU4 original sequence version: 144 3042B443A3755762 q9hce7-1 E3 ubiquitin-protein ligase SMURF1 SMURF1 KIAA1625 HECT-type E3 ubiquitin transferase SMURF1 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE DIP protein Q9HCE7-1 original sequence version: 105 DIP protein Q9HCE7 original sequence version: 116 smad7_human Mothers against decapentaplegic homolog 7 SMAD7 MADH7 MADH8 Mothers against decapentaplegic homolog 8 SMAD family member 7 protein protein human Homo sapiens Human MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR DIP protein O15105 original sequence version: 121 DIP protein O15105 original sequence version: 131 DIP protein O15105 original sequence version: 139 smad1_human Mothers against decapentaplegic homolog 1 Mad-related protein 1 SMAD family member 1 Transforming growth factor-beta-signaling protein 1 JV4-1 SMAD1 BSP1 MADH1 MADR1 protein protein human Homo sapiens Human MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS DIP protein Q15797 original sequence version: 167 DIP protein Q15797 original sequence version: 145 DIP protein Q15797 original sequence version: 133 2DD34B7F434DBC7E smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS DIP protein Q15796 original sequence version: 174 DIP protein Q15796 original sequence version: 100 DIP protein Q15796-1 original sequence version: 141 95406DB5FC0AA4C9 smad7-smurf2-1 2 9 unspecified role unspecified role unspecified role unspecified role Region 203-217 Region 203-217 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role WW3 domain Region 297-333 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smad7-smurf2-2 5 9 unspecified role unspecified role unspecified role unspecified role Region 203-217 Region 203-217 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role WW23 domain Region 250-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smad2-smurf2-3 1 11 unspecified role unspecified role unspecified role unspecified role Region 214-233 Region 214-233 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role WW23 domain Region 250-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smad1-smurf2-3 4 10 unspecified role unspecified role unspecified role unspecified role Region 215-236 Region 215-236 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role WW23 domain Region 250-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smad7-smurf2-3 3 9 unspecified role unspecified role unspecified role unspecified role Region 203-217 Region 203-217 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role WW23 domain Region 250-333 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction smad7-smurf1-1 6 8 unspecified role unspecified role unspecified role unspecified role WW2 domain 294-342 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 203-217 Region 203-217 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction