DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220490X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220489X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220487X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220488X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. q9ag19_neigo Cell division inhibitor MinD E8M63_02800 WHOF_00561 WHOF_02109C minD minD_1 WHOM_01818 minD_2 WHOM_02201 Septum site-determining protein MinD protein protein neigo Neisseria gonorrhoeae MAKIIVVTSGKGGVGKTTTSASIATGLALRGYKTAVIDFDVGLRNLDLIMGCERRVVYDLINVIQGEATLNQALIKDKNCENLFILPASQTRDKDALTREGVEKVMQELSGKKMGFEYIICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHLLITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVLQASNSGEPVIHQDSVAASEAYKDVIARLLGENREMRFLEAEKKSFFKRLFGG DIP protein Q9AG19 original sequence version: 28 mine_neigo Cell division topological specificity factor minE protein protein neigo Neisseria gonorrhoeae MSLIELLFGRKQKTATVARDRLQIIIAQERAQEGQTPDYLPTLRKELMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKV DIP protein P58152 original sequence version: 34 mine-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mind-mine-5 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role P58152:p.Ala18Asp A18D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A D This feature has been corrected as a result of our quality control procedures. The original label was 'A18D'. Wed May 02 20:21:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala18asp' Tue Jun 30 19:26:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala18Asp' P58152:p.Leu22Asp L22D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L22D'. Wed May 02 16:45:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu22asp' Tue Jun 30 19:26:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu22Asp' P58152:p.Arg19Ala R19A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R19A'. Wed May 02 18:34:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg19ala' Tue Jun 30 20:12:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg19Ala' P58152:p.Arg21Ala R21A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R21A'. Wed May 02 14:55:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg21ala' Tue Jun 30 20:15:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg21Ala' ecolx Escherichia coli direct interaction direct interaction mine-2 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mind-mine-6 2 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 6 enzyme regulator enzyme regulator unspecified role unspecified role P58152:p.Arg21Ala R21A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R21A'. Wed May 02 18:37:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg21ala' Tue Jun 30 19:38:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg21Ala' Region 1-22 Region 1-22 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P58152:p.Ile25Arg I25R/A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I R Wed May 02 16:04:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile25arg' Tue Jun 30 19:01:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile25Arg' P58152:p.Leu22Asp L22D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L22D'. Wed May 02 20:20:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu22asp' Tue Jun 30 16:07:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu22Asp' P58152:p.Leu22Ala L22A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L22A'. Wed May 02 16:40:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu22ala' Tue Jun 30 15:54:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu22Ala' P58152:p.Ile25Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I A Wed May 02 14:38:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile25ala' Tue Jun 30 19:23:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile25Ala' in vitro In vitro direct interaction direct interaction