DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Nature 2010 imex curation Ito T., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ito T., Yokoyama S. DIP original experiment: DIP-219354X Nature 2010 IMEx Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Nature 2010 imex curation Ito T., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ito T., Yokoyama S. DIP original experiment: DIP-219353X Nature 2010 IMEx Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. Nature 2010 imex curation Ito T., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ito T., Yokoyama S. DIP original experiment: DIP-219352X Nature 2010 IMEx Two enzymes bound to one transfer RNA assume alternative conformations for consecutive reactions. sye2_thema Glutamate--tRNA ligase 2 gltX2 Glutamyl-tRNA synthetase 2 TM_1875 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MFITGAFFDILEVGPKKIRRCFELVRVRFAPSPTGHLHVGGARTALFNWMFARKEGGKFILRIEDTDTERSSREYEQQILESLRWCGLDWDEGPDIGGDFGPYRQSERLEIYREYAEKLVEDKRAYYVVYDKEDPSKELFTTYEYPHEYKEKGHPVTIKFKVLPGKTSFEDLLKGYMEFDNSTLEDFIIMKSNGFPTYNFAVVVDDHLMRISHVFRGEDHLSNTPKQLMIYEAFGWEAPVFMHIPLILGSDRTPLSKRHGATSVEHFRREGILSRALMNYLALLGWRVEGDEIFTIEEKLQSFDPKDISNKGVIFDYQKLEWVNGKHMRRIDLEDLKREFIEWAKYAGKEIPSVDERYFSETLRICREKVNTLSQLYDIMYPFMNDDYEYEKDYVEKFLKREEAERVLEEAKKAFKDLNSWNMEEIEKTLRDLSEKGLASKKVVFQLIRGAVTGKLVTPGLFETIEVLGKERTLKRLERTLQFLKKT 5E15A2E9E1580791 5E15A2E9E1580791 gatc_thema Glutamyl-tRNA(Gln) amidotransferase subunit C gatC TM_0252 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MIKVTKDLVLHLENLARLELSEDQRESLMKDFQEILDYVELLNEVDVEGVEPMYTPVEDSAKLRKGDPRFFEMRDLIKKNFPEEKDGHIKVPGIHR C3CAE53D43EA4404 C3CAE53D43EA4404 gatb_thema Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B gatB TM_1273 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MRYRPVIGLEIHVQLSTKTKAFCSCPADVFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKIHKYSRFDRKNYFYPDLPKGYQISQYFYPIATEGFLEIDGDEGRKKVRIRRLHLEEDAGKLVHEGDSITRASYSLVDMNRCGVPLIEIVTEPDISSPREARVFMEKLRSIVRYLGVSTGDMEKGALRCDANISVVDTETGRQSNRVEVKNMNSFRFVERALEYEFERIVKAMERGEDVERETRGWDMATKITVSMRGKEEESDYRYFPEPDIPPVVLSDEYLEEVKKELPELPDEKAERFMREYGLPEYDAKVLTSSKELAEFFEECVKVVNRPKDLSNWIMTEVLRELNERNIEITESKLTPQHFADLFKLMDEGKISIKIAKEIFPEVFETGKMPSQIVEEKGLTQINDEKLIEELVKKAMEQNPKAVQDYKSGKKKAAGFFVGYVMRETKGKANPELTNRIIQKLLEGE 34988170E32F312F 34988170E32F312F gata_thema Glutamyl-tRNA(Gln) amidotransferase subunit A gatA TM_1272 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MIDLDFRKLTIEECLKLSEEEREKLPQLSLETIKRLDPHVKAFISVRENVSVEKKGKFWGIPVAIKDNILTLGMRTTCASRILENYESVFDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCGVVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIEEGVSGMKFAVPEEIYEHDIEEGVSERFEEALKLLERLGAKVERVKIPHIKYSVATYYVIAPAEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFTIPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIEKNSPYNENGMFPLPEVKA 4F01EA3A2DCBD9A0 4F01EA3A2DCBD9A0 gata-gatb-5 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association gata-gatb-6 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association gata-gatb-7 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association