DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. Only protein-protein interactions saltm Salmonella typhimurium anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. DIP original experiment: DIP-221344X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. Only protein-protein interactions saltm Salmonella typhimurium bn-page blue native page bn-page de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. DIP original experiment: DIP-221345X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. Only protein-protein interactions saltm Salmonella typhimurium bn-page blue native page bn-page de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. DIP original experiment: DIP-221343X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. Only protein-protein interactions saltm Salmonella typhimurium bn-page blue native page bn-page de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. DIP original experiment: DIP-221341X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Organization and coordinated assembly of the type III secretion export apparatus. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. Only protein-protein interactions saltm Salmonella typhimurium anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wagner S., Königsmaier L., Lara-Tejero M., Lefebre M., Marlovits TC., Galán JE. DIP original experiment: DIP-221342X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Organization and coordinated assembly of the type III secretion export apparatus. prgk_salty Lipoprotein PrgK prgK STM2871 protein protein salty Salmonella typhimurium MIRRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNIEANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPRVEIAQMFPADSLVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGRPPKPVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVVLSERSDAQLQAPGTPVKRNSFATSWIVLIILLSVMSAGFGVWYYKNHYARNKKGITADDKAKSSNE 2C0A6FC06667E256 prgi_salty Protein PrgI prgI STM2873 protein protein salty Salmonella typhimurium MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR ED1F8967877585F8 spaq_salty Surface presentation of antigens protein SpaQ spaQ STM2889 protein protein salty Salmonella typhimurium MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG 3058D82ECE128892 inva_salty Invasion protein InvA invA STM2896 protein protein salty Salmonella typhimurium MLLSLLNSARLRPELLILVLMVMIISMFVIPLPTYLVDFLIALNIVLAILVFMGSFYIDRILSFSTFPAVLLITTLFRLALSISTSRLILIEADAGEIIATFGQFVIGDSLAVGFVVFSIVTVVQFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERESQLYGSFDGAMKFIKGDAIAGIIIIFVNFIGGISVGMTRHGMDLSSALSTYTMLTIGDGLVAQIPALLIAISAGFIVTRVNGDSDNMGRNIMTQLLNNPFVLVVTAILTISMGTLPGFPLPVFVILSVVLSVLFYFKFREAKRSAAKPKTSKGEQPLSIEEKEGSSLGLIGDLDKVSTETVPLILLVPKSRREDLEKAQLAERLRSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIRVEQFTVYFDLMRVVNYSDEVVSFGINPTIHQQGSSQYFWVTHEEGEKLRELGYVLRNALDELYHCLAVTLARNVNEYFGIQETKHMLDQLEAKFPDLLKEVLRHATVQRISEVLQRLLSERVSVRNMKLIMEALALWAPREKDVINLVEHIRGAMARYICHKFANGGELRAVMVSAEVEDVIRKGIRQTSGSTFLSLDPEASANLMDLITLKLDDLLIAHKDLVLLTSVDVRRFIKKMIEGRFPDLEVLSFGEIADSKSVNVIKTI 5C293D9E4A69917E sctc1_salty SPI-1 type 3 secretion system secretin sctC1 Protein InvG invG STM2898 protein protein salty Salmonella typhimurium MKTHILLARVLACAALVLVTPGYSSEKIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGIELGRQKIGVMRLNNTFVGDRTYNLRDQKMVIPGIATAIERLLQGEEQPLGNIVSSEPPAMPAFSANGEKGKAANYAGGMSLQEALKQNAAAGNIKIVAYPDTNSLLVKGTAEQVHFIEMLVKALDVAKRHVELSLWIVDLNKSDLERLGTSWSGSITIGDKLGVSLNQSSISTLDGSRFIAAVNALEEKKQATVVSRPVLLTQENVPAIFDNNRTFYTKLIGERNVALEHVTYGTMIRVLPRFSADGQIEMSLDIEDGNDKTPQSDTTTSVDALPEVGRTLISTIARVPHGKSLLVGGYTRDANTDTVQSIPFLGKLPLIGSLFRYSSKNKSNVVRVFMIEPKEIVDPLTPDASESVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK 8022905BE256058D spap_salty Surface presentation of antigens protein SpaP spaP STM2890 protein protein salty Salmonella typhimurium MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLSMFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGFYLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT 18241189C38D4F20 spar_salty Surface presentation of antigens protein SpaR spaR STM2888 protein protein salty Salmonella typhimurium MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE B267D1EB643DA3C5 prgj_salty Protein PrgJ prgJ STM2872 protein protein salty Salmonella typhimurium MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS 7AC04EF792D72598 prgh_salty Protein PrgH prgH STM2874 protein protein salty Salmonella typhimurium METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNGIVAALAGFFILGIGTVGTLWILNSPQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL 6381EED985F33CA9 spas_salty Surface presentation of antigens protein SpaS spaS STM2887 protein protein salty Salmonella typhimurium MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSYGSFNEFMGIIKIIIADNFDQSMADYSLAVFGIGLKYLIPFMLLCLVCSALPALLQAGFVLATEALKPNLSALNPVEGAKKLFSMRTVKDTVKTLLYLSSFVVAAIICWKKYKVEIFSQLNGNIVGIAVIWRELLLALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKEQEGNPEVKSKRREVHMEILSEQVKSDIENSRLIVANPTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIKLARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKDVIQPQENEVRH 5860259314317CF8 inva-invg-1 4 8 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 12 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 15 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range saltm Salmonella typhimurium 11 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 7 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 13 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 14 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 6 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 10 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 9 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium physical association physical association spap-spar-1 1 12 unspecified role unspecified role prey prey saltm Salmonella typhimurium 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range saltm Salmonella typhimurium physical association physical association spas-inva-1 5 8 unspecified role unspecified role prey prey saltm Salmonella typhimurium 12 unspecified role unspecified role prey prey saltm Salmonella typhimurium 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range saltm Salmonella typhimurium 11 unspecified role unspecified role prey prey saltm Salmonella typhimurium 7 unspecified role unspecified role prey prey saltm Salmonella typhimurium 13 unspecified role unspecified role prey prey saltm Salmonella typhimurium 14 unspecified role unspecified role prey prey saltm Salmonella typhimurium 6 unspecified role unspecified role prey prey saltm Salmonella typhimurium 10 unspecified role unspecified role prey prey saltm Salmonella typhimurium 9 unspecified role unspecified role prey prey saltm Salmonella typhimurium association association spap-spar-2 2 12 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 11 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range saltm Salmonella typhimurium direct interaction direct interaction inva-invg-2 3 15 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 11 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 7 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 13 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 14 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 6 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 10 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium 9 unspecified role unspecified role unspecified role unspecified role saltm Salmonella typhimurium physical association physical association