DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220763X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down anti tag western anti tag western blot anti tag western Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220754X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220759X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down anti tag western anti tag western blot anti tag western Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220753X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220757X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220756X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220758X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down ms participant Identification by mass spectrometry ms participant Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220752X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220755X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220762X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220760X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Asterless is a scaffold for the onset of centriole assembly. Nature 2010 imex curation Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Dzhindzhev NS., Yu QD., Weiskopf K., Tzolovsky G., Cunha-Ferreira I., Riparbelli M., Rodrigues-Martins A., Bettencourt-Dias M., Callaini G., Glover DM. DIP original experiment: DIP-220761X Nature 2010 IMEx Asterless is a scaffold for the onset of centriole assembly. hsp7d_drome Heat shock 70 kDa protein cognate 4 Hsc70-4 Hsc4 CG4264 Heat shock 70 kDa protein 88E protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD DIP protein P11147 original sequence version: 115 DIP protein P11147 original sequence version: 155 30F6BD7E07407B63 tbb3_drome Tubulin beta-3 chain betaTub60D TubB60C CG3401 Beta-3-tubulin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADDEFDPEVNQEEVEGDCI DIP protein P08841 original sequence version: 110 573DD088E5664D57 plk4_human Serine/threonine-protein kinase PLK4 Polo-like kinase 4 Serine/threonine-protein kinase Sak Serine/threonine-protein kinase 18 PLK4 SAK STK18 protein protein human Homo sapiens Human MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSSTSISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRVIQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERYSPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWFGNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQNTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLADRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPGADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICLALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH DIP protein O00444 original sequence version: 88 DIP protein O00444-1 original sequence version: 93 DIP protein O00444 original sequence version: 145 DIP protein O00444-1 original sequence version: 145 DIP protein O00444 original sequence version: 132 DIP protein O00444-1 original sequence version: 132 DIP protein O00444 original sequence version: 135 4D56F5FD983211A6 q9vi72_drome CPAP D-Sas4 d-SAS-4 dsas-4 D-sas4 DSAS-4 DSas-4 DSas4 Dmel\CG10061 Dsas-4 Dsas4 SAS-4 SAS4 Sas4 l(3)S2214 l(3)s2214 sas-4 sas4 Dmel_CG10061 Sas-4 CG10061 DmSas4 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQEAGESPVGMPLSQEAIAQRLAALSRWQDEQKRLLQERQSNHRVLLGLEQRNMYKMLGLLHQETESHENSVLEEWDEEHSIQMPRLAADPDEHEPEISMADPQPAKPKRPFLRRGEGLKQRFKINPDQLRLENLPRYKFANAHPQFRTPQMKKGILKKQVKSPPNPAPPPAPKPSAQLDDLNEQRFQQMLIGKNACSSTPDLKSSYASSTTASSTSPRVRFVEQKSRAGQTTHADDEASSEASPMTGVCWAKVLDTQSIKPAQIQRRSAQIRVEDDSNVSIFELLEQKATEGNIDMNSSCIRTFMARKDQRRRVADDSDHIVVTQQVRQMRLQPQVDQMLVQELQEGDEEDTEPSSDQTLTMTPIQVGNTKVRVRFSDSNDTHEYSDATSLNDGSNIQLFEQFKSALFQALEQKKKSSPSKESDEPITKDLQEKANLVRTRLEELETEIATFKEQNAQLLRLRQQHELEKAKCTQDHMEAMERVHDEKIQAEIYLHDERMKIEEERRKFEQQMRLQKSNANSKEKKEIAALKQEVEGLQLQLKQKEQAHVSAQARLRAQLRASEKEQRNYRDEIELLRKENKRLEQELVKIGRENNSKMLQEINRNIARLAPKVLPSATMSDILDENGRRTQSLDGTAGKPAKQREAQNRRQSSGSAQVRSRSRSLSRNKKTPYALDESYASSSSVESEEVQPPVTAPKAATPPPAANSSSDFKREITNADGSKDIWYPNGNLKKISADGMNLRMLYFNKDIKETNIREGTVKYYYAETNTWHTSYLDGLEILEFPNGQTEHRRKDGTVEIHFPNNSIKIVDPSDTEKLEEWRYADGTHLVQLRNGDKILNLPNGQKEIHTKLNKRREYPDGTVKLVYPDGSQETRYSNGRVRLKDKDGKLIMDTDYAKY DIP protein Q9VI72 original sequence version: 64 DIP protein Q9VI72 original sequence version: 92 8A0765CA0A92E492 tba1_drome Tubulin alpha-1 chain alphaTub84B tubA84B CG1913 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDSGDGEGEGAEEY DIP protein P06603 original sequence version: 105 E4521F429F5045D2 o77430_drome SkpA Dredd EG:115C2.4 skpA skpA-RC skpA-RH Dmel\CG16983 SKP1 SKPA Skp Skp1 anon-WO03040301.234 anon-WO03040301.236 anon-WO03040301.238 dSKP1 dSkp-1 dSkpA dskpA l(1)G0037 l(1)G0058 l(1)G0109 l(1)G0389 spkA Dmel_CG16983 CG16983 dSkip-1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWCEEK DIP protein O77430 original sequence version: 87 DIP protein O77430 original sequence version: 114 FD218D30AC98CA0A o94986-3 Centrosomal protein of 152 kDa CEP152 KIAA0912 protein protein human Homo sapiens Human MSLDFGSVALPVQNEDEEYDEEDYEREKELQQLLTDLPHDMLDDDLSSPELQYSDCSEDGTDGQPHHPEQLEMSWNEQMLPKSQSVNGYNEIQSLYAGEKCGNVWEENRSKTEDRHPVYHPEEGGDEGGSGYSPPSKCEQTDLYHLPENFRPYTNGQKQEFNNQATNVIKFSDPQWNHFQGPSCQGLEPYNKVTYKPYQSSAQNNGSPAQEITGSDTFEGLQQQFLGANENSAENMQIIQLQVLNKAKERQLENLIEKLNESERQIRYLNHQLVIIKDEKDGLTLSLRESQKLFQNGKEREIQLEAQIKALETQIQALKVNEEQMIKKSRTTEMALESLKQQLVDLHHSESLQRAREQHESIVMGLTKKYEEQVLSLQKNLDATVTALKEQEDICSRLKDHVKQLERNQEAIKLEKTEIINKLTRSLEESQKQCAHLLQSGSVQEVAQLQFQLQQAQKAHAMSANMNKALQEELTELKDEISLYESAAKLGIHPSDSEGELNIELTESYVDLGIKKVNWKKSKVTSIVQEEDPNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQLQNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSEKPKNQLWPESSTSDVVRDDILLLKNEIQVLQQQNQELKETEGKLRNTNQDLCNQMRQMVQDFDHDKQEAVDRCERTYQQHHEAMKTQIRESLLAKHALEKQQLFEAYERTHLQLRSELDKLNKEVTAVQECYLEVCREKDNLELTLRKTTEKEQQTQEKIKEKLIQQLEKEWQSKLDQTIKAMKKKTLDCGSQTDQVTTSDVISKKEMAIMIEEQKCTIQQNLEQEKDIAIKGAMKKLEIELELKHCENITKQVEIAVQNAHQRWLGELPELAEYQALVKAEQKKWEEQHEVSVNKRISFAVSEAKEKWKSELENMRKNILPGKELEEKIHSLQKELELKNEEVPVVIRAELAKARSEWNKEKQEEIHRIQEQNEQDYRQFLDDHRNKINEVLAAAKEDFMKQKTELLLQKETELQTCLDQSRREWTMQEAKRIQLEIYQYEEDILTVLGVLLSDTQKEHISDSEDKQLLEIMSTCSSKWMSVQYFEKLKGCIQKAFQDTLPLLVENADPEWKKRNMAELSKDSASQGTGQGDPGPAAGHHAQPLALQATEAEAEENNKVVEELIEENNDMKNKLEELQTLCKTPPRSLSAGAIENACLPCSGGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRKYYLICLQQILQDDGKEGAEKKIMNAASKLATMAKLLETPISSKSQSKTTQSALPLTSEMLIAVKKSKRNDVNQKIPCCIESKSNSVNTITRTLCEQAPKRRAACNLQRLLENSEHQSIKHVGSKETHLEFQFGDGSCKHLNSLPRNVSPEFVPCEGEGGFGLHKKKDLLSDNGSESLPHSAAYPFLGTLGNKPSPRCTPGPSESGCMHITFRDSNERLGLKVYKCNPLMESENAASEKSQGLDVQEPPVKDGGDLSDCLGWPSSSATLSFDSREASFVHGRPQGTLEIPSESVKSKQFSPSGYLSDTEESNMICQTMKCQRYQTPYLSEETTYLEPGKISVNCGHPSRHKADRLKSDFKKLSSTLPSSVCQQPSRKLIVPLSSQQDSGFDSPFVNLD DIP protein O94986-3 original sequence version: 71 DIP protein O94986-3 original sequence version: 120 DIP protein O94986-3 original sequence version: 107 No experimental confirmation available. q9vde3_drome slmb beta-TrCP BcDNA:GM02031 Beta-TRCP1 Dmel\CG3412 FBXW1 MENE (3R)-B MENE(3R)-B SLIMB SLMB Slimb Slmb beta-TRCP betaTrCP crd ica l(3)00295 shv slimb wel Dmel_CG3412 CG3412 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMKMETDKIMDETNSNAQAFTTTMLYDPVRKKDSSPTYQTERELCFQYFTQWSESGQVDFVEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKPRPGQTQRPHSFHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLNFTPNENKTGRTPSPALMEH DIP protein Q9VDE3 original sequence version: 100 DIP protein Q9VDE3 original sequence version: 116 DIP protein Q9VDE3 original sequence version: 118 DIP protein Q9VDE3 original sequence version: 135 F4D5DF126F58A012 tbb1_drome Tubulin beta-1 chain betaTub56D CG9277 Beta-1-tubulin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEDAEFEEEQEAEVDEN DIP protein Q24560 original sequence version: 85 9E6F66C5C96731DB plk4_drome Serine/threonine-protein kinase PLK4 SAK CG7186 Polo-like kinase 4 Serine/threonine-protein kinase SAK protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLSNRAFGETIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLKCSNGGHSAPGALNVFSQSMESGDSGIITFASSDSRNSQQIRSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRPITDVQPAQRLDGLRDTTNIAFSTPKSNQGSINFSLSTISSTRNTSDFGTNCSRSNMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDGSVVSVIPSMQGGGITYTQPNGTSTHFGKGDDLPFPVRDRVGQIPNIQLKLKTAPLLGSGRKTDYNNAMTPKTTTPYYNRMLL DIP protein O97143 original sequence version: 100 DIP protein O97143 original sequence version: 130 DIP protein O97143 original sequence version: 114 F050BF60A5D94AA4 q9vne4_drome DmAsl asl CG2919 ASL Asl Dmel\CG2919 mecD sdu Dmel_CG2919 Cep152 MecD protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNTPGISLFQGADALNINSTLDRQEEEEALQDQKRREEELGRIMVNAFDDLLDEENTIDSTTNYQSELEQPPVLPNYPSHPHHKPLQDDAQRANEIEMHRLQILLESKNNELQNVNQVANAAHKKLDDLQKHLSIMQAELDRAIREKQNTHELLVETKETCSNKDSDLDKLRSEKKQLEEDNTRLVGQLEAAKTLLTDVQSKYDMVQASKQKWEERNADLRLKQMEEAHRAQSDLLQQQLCQMKDQLDRKQNELDQINSRYNALQSGHETMLVDKAAKINELSQALDEAQMRCNQLSARPDLQAENRRQQQCIVDLKARIAYLEQTVASLHERLNETTTELDLIDSVIQQHQADESPTSRLSQMGGSRLVGSTPLNPLDRVGHIKQELYRALGNLKNKREEVRRLEKLLEERNQELRVLRDQENQSLVQLETLNEGKMRLENKVKAMQQELEEQKHRSQQESDVHSQLNSIVAERDALREKRQQIEEDLEQLKQQNESLQRNYDQLSQENRQLRTRETADNLRLELERHKILLRDSQSEVERLKKLYSDIATDKESLGYELRKLRESDTLKELQDQRQNLATVQRNLQLAEMKSEELKKLLETEKLSHERDLQALRQRSEREKREEAVAVAKESSENCSKCIESIAEITKAEIQLLKLQNVNSMQAKELKELEHALEQSKNLQAEMQEKIELSNKQDELISDLKERAKQFEAYIRQQEEHKQQNKCTPSPKSNSVSPSDPSPKELTQNRIRLIEQRVRDEMAKLFAAELKRFTNRLQKSEERSQCLQREYQTVCAELQQRQTEVDLLKQTILAERENIDEILAGREEKQKEMLQKCRQELQAKNQRIAELLREVEEQHASIDSERQSMKAVMAQWEKQRQSVDQVEHHWRQQLESLRSTHEEAMRSAQQRYQSAKRTAHNYKLYAEDKEAHMKREYERIKHEYELSLAKIEATMNQHLERRSREKHRDKENVPSNSSSDPITNSNRKPKGNGHS DIP protein Q9VNE4 original sequence version: 59 DIP protein Q9VNE4 original sequence version: 88 DIP protein Q9VNE4 original sequence version: 90 DIP protein Q9VNE4 original sequence version: 107 DIP protein Q9VNE4 original sequence version: 73 75A90C8496BA9EC5 cenpj_human Centromere protein J CENPJ CPAP LAP LIP1 Centrosomal P4.1-associated protein LAG-3-associated protein LYST-interacting protein 1 protein protein human Homo sapiens Human MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADKEKRAAVDISTSFPIKGTHFSDSFSFINEEDSLLEEQKLESNNPYKPQSDKSETHTAFPCIKKGPQVAACHSAPGHQEENKNDFIPDLASEFKEGAYKDPLFKKLEQLKEVQQKKQEQLKRQQLEQLQRLMEEQEKLLTMVSGQCTLPGLSLLPDDQSQKHRSPGNTTTGERATCCFPSYVYPDPTQEETYPSNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIGERKQTFEDYLEEQIQLEEQELKQKQLKEAEGPLPIKAKPKQPFLKRGEGLARFTNAKSKFQKGKESKLVTNQSTSEDQPLFKMDRQQLQRKTALKNKELCADNPILKKDSKARTKSGSVTLSQKPKMLKCSNRKSLSPSGLKIQTGKKCDGQFRDQIKFENKVTSNNKENVTECPKPCDTGCTGWNKTQGKDRLPLSTGPASRLAAKSPIRETMKESESSLDVSLQKKLETWEREKEKENLELDEFLFLEQAADEISFSSNSSFVLKILERDQQICKGHRMSSTPVKAVPQKTNPADPISHCNRSEDLDHTAREKESECEVAPKQLHSLSSADELREQPCKIRKAVQKSTSENQTEWNARDDEGVPNSDSSTDSEEQLDVTIKPSTEDRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVKRGEDLSKSRRSRSPPTSELMMKFFPSLKPKPKSDSHLGNELKLNISQDQPPGDNARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRLDAWKRAEAIESSLEVEKKDKLANTSVRFQNSQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGNLDKGQAASPREPLEPLNFPDPEYKEEEEDQDIQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQEESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEGNVLMDTEL DIP protein Q9HC77 original sequence version: 70 DIP protein Q9HC77 original sequence version: 99 B4E6531B62A30F2D asl-sas_4-1 11 16 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 23 unspecified role unspecified role bait bait Region 648-995 Region 648-995 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sak-alphatub84b-1 8 17 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 21 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 18 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 20 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 23 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 22 unspecified role unspecified role bait bait PrA-tag PrA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly association association cep152-cenpj-1 1 24 unspecified role unspecified role prey prey N-terminal domain Region 1-670 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminal domain Region 784-1654 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sak-asl-1 4 23 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 22 unspecified role unspecified role bait bait PrA-tag PrA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association asl-sak-1 9 23 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range N-terminal domain Region 1-400 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Cryptic polo box domain Region 376-525 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sak-asl-2 7 23 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region Δ24-55 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ24-55'. ecolx Escherichia coli 22 unspecified role unspecified role bait bait PrA-tag PrA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sak-asl-3 3 23 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region Δ24-55 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ24-55'. drome Drosophila melanogaster (Fruit fly) Fruit fly 22 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association asl-sak-2 5 23 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range N-terminal domain Region 1-400 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role prey prey Region 301-525 Region 301-525 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 376-600 Region 376-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction asl-sas_4-2 12 16 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 101-901 Region 101-901 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-650 Region 1-650 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 23 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 648-995 Region 648-995 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction sak-asl-4 6 23 unspecified role unspecified role prey prey N-terminal domain Region 1-300 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region Δ24-55 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ24-55'. ecolx Escherichia coli direct interaction direct interaction sak-asl-5 2 23 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 22 unspecified role unspecified role bait bait PrA-tag PrA-tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association plk4-cep152-1 10 19 unspecified role unspecified role prey prey Region 1-445 Region 1-445 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 15 unspecified role unspecified role bait bait Cryptic polo box domain Region 632-809 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction