DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252391X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252392X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252393X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252395X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252397X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252396X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. Structure (London, England : 1993) 2010 imex curation Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang F., Yang Y., Singh TR., Busygina V., Guo R., Wan K., Wang W., Sung P., Meetei AR., Lei M. DIP original experiment: DIP-252394X Structure (London, England : 1993) 2010 IMEx Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex. q96e14-1 RecQ-mediated genome instability protein 2 RMI2 C16orf75 BLM-associated protein of 18 kDa protein protein human Homo sapiens Human MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP DIP protein Q96E14-1 original sequence version: 59 DIP protein Q96E14 original sequence version: 59 top3a_human DNA topoisomerase 3-alpha DNA topoisomerase III alpha TOP3A TOP3 protein protein human Homo sapiens Human MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRRREGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYISYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQHPQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLESEARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR DIP protein Q13472 original sequence version: 135 DIP protein Q13472 original sequence version: 93 DIP protein Q13472-1 original sequence version: 127 06558C749569E0C2 blm_human Bloom syndrome protein RecQ protein-like 3 DNA helicase, RecQ-like type 2 BLM RECQ2 RECQL3 protein protein human Homo sapiens Human MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVLRNKDVNVTEDFSFSEPLPNTTNQQRVKDFFKNAPAGQETQRGGSKSLLPDFLQTPKEVVCTTQNTPTVKKSRDTALKKLEFSSSPDSLSTINDWDDMDDFDTSETSKSFVTPPQSHFVRVSTAQKSKKGKRNFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDDGPIAEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDTDFVPPSPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS DIP protein P54132 original sequence version: 155 DIP protein P54132 original sequence version: 109 DIP protein P54132 original sequence version: 146 DIP protein P54132 original sequence version: 111 423DF5F381194E11 rmi1_human RecQ-mediated genome instability protein 1 BLM-associated protein of 75 kDa FAAP75 RMI1 C9orf76 protein protein human Homo sapiens Human MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK DIP protein Q9H9A7 original sequence version: 104 DIP protein Q9H9A7 original sequence version: 66 DIP protein Q9H9A7 original sequence version: 97 2BB449363DBF76B7 rmi1-rmi2-5 1 11 unspecified role unspecified role bait bait C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association rmi2-blm-2 5 10 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait Q96E14-1:p.Met134Arg M134R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R This feature has been corrected as a result of our quality control procedures. The original label was 'M134R'. Wed May 02 18:29:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met134arg' Tue Jun 30 18:18:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met134Arg' Q96E14-1:p.Asp141Ala D141A/R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:45:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp141ala' Tue Jun 30 17:27:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp141Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q96E14-1:p.Asp141Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R Wed May 02 19:45:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp141arg' Tue Jun 30 19:30:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp141Arg' human Homo sapiens Human association association rmi1-rmi2-6 3 11 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rmi1-blm-1 4 10 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human association association rmi2-rmi1-2 2 11 unspecified role unspecified role prey prey C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rmi1-rmi2-7 6 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association rmi1-rmi2-8 7 11 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 475-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 6-147 Region 6-147 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction