DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221319X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221320X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221321X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221317X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221322X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221318X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221316X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Shi Y., Suh YH., Milstein AD., Isozaki K., Schmid SM., Roche KW., Nicoll RA. DIP original experiment: DIP-221323X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. ccg2_rat Voltage-dependent calcium channel gamma-2 subunit Cacng2 Neuronal voltage-gated calcium channel gamma-2 subunit Transmembrane AMPAR regulatory protein gamma-2 Stargazin Stg protein protein rat Rattus norvegicus (Rat) Rat MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV DIP protein Q71RJ2 original sequence version: 44 DIP protein Q71RJ2 original sequence version: 53 mint AA9D475606A0FBA4 gria1_mouse Glutamate receptor 1 GluR-A GluR-K1 Glutamate receptor ionotropic, AMPA 1 AMPA-selective glutamate receptor 1 Gria1 Glur1 protein protein mouse Mus musculus Mouse MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQDFPKSMQSIPCMSHSSGMPLGATGL DIP protein P23818 original sequence version: 116 F0FF7031DADD7CEB gria1_rat Glutamate receptor 1 Gria1 GluR-A GluR-K1 Glutamate receptor ionotropic, AMPA 1 AMPA-selective glutamate receptor 1 Glur1 protein protein rat Rattus norvegicus (Rat) Rat MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGMPLGATGL DIP protein P19490 original sequence version: 146 DIP protein P19490 original sequence version: 142 DIP protein P19490 original sequence version: 117 DIP protein P19490 original sequence version: 127 DIP protein P19490 original sequence version: 131 DIP protein P19490 original sequence version: 129 2D4CFA7CCD532838 ccg2_mouse Voltage-dependent calcium channel gamma-2 subunit Neuronal voltage-gated calcium channel gamma-2 subunit Stargazin Cacng2 Stg Transmembrane AMPAR regulatory protein gamma-2 protein protein mouse Mus musculus Mouse MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV DIP protein O88602 original sequence version: 93 AA9D475606A0FBA4 cnih2_rat Protein cornichon homolog 2 Cnih2 Cornichon family AMPA receptor auxiliary protein 2 Cornichon-like protein protein protein rat Rattus norvegicus (Rat) Rat MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF DIP protein Q5BJU5 original sequence version: 51 cacng2-gria1-4 6 9 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association gria1-cacng2-1 8 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association gria1-cacng2-2 7 9 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 13 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat association association gria1-cnih2-1 1 13 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gria1-cacng2-3 3 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association gria1-cacng2-4 5 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association cnih2-cacng2-1 4 9 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 13 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association gria1-cacng2-5 2 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association