DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219412X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219406X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219408X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219407X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219410X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219413X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219409X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Nature 2010 imex curation Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219411X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. rel_mouse Proto-oncogene c-Rel Rel protein protein mouse Mus musculus Mouse MASSGYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGERSTDNNRTYPSVQIMNYYGKGKIRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGPERRPLFFQNLGIRCVKKKEVKGAIILRISAGINPFNVGEQQLLDIEDCDLNVVRCVFMFFLPDEDGNFTTALPPIVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEARGVFSQADVHRQVAIVFKTPPYCKAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQDCGHFTEKPRTAPLGSTGEGRFIKKESNLFSHGTVLPEMPRSSGVPGQAEPYYSSCGSISSGLPHHPPAIPSVAHQPTSWPPVTHPTSHPVSTNTLSTFSAGTLSSNSQGILPFLEGPGVSDLSASNSCLYNPDDLARMETPSMSPTDLYSISDVNMLSTRPLSVMAPSTDGMGDTDNPRLVSINLENPSCNARLGPRDLRQLHQMSPASLSAGTSSSSVFVSQSDAFDRSNFSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI DIP protein P15307 original sequence version: 88 98FC237B6D140416 p25799-1 Nuclear factor NF-kappa-B p105 subunit p105 Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI DIP protein P25799-1 original sequence version: 125 DIP protein P25799 original sequence version: 135 DIP protein P25799 original sequence version: 126 DIP protein P25799 original sequence version: 145 DIP protein P25799 original sequence version: 149 91EA9C595E375C30 ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL DIP protein Q9Z1E3 original sequence version: 86 DIP protein Q9Z1E3 original sequence version: 127 DIP protein Q9Z1E3 original sequence version: 91 E1783F8E1BA93813 tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 ikbb_mouse NF-kappa-B inhibitor beta I-kappa-B-beta Nfkbib Ikbb protein protein mouse Mus musculus Mouse MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDEDDKLSPCSSSGSDSDSDNRDEGDEYDDIVVHSGRSQNRQPPSPASKPLPDDPNPA DIP protein Q60778 original sequence version: 86 0E2B46C89E2404EF nfkbib-rel-1 2 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association rela-nfkbib-10 6 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association rel-nfkb1-1 7 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association rel-nfkbib-1 1 9 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association rela-nfkb1-11 3 10 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association rela-nfkb1-16 4 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association rel-nfkbib-2 8 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association rel-nfkbia-1 5 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association