DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221289X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221298X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221292X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221294X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221287X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221293X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221288X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221290X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221291X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221299X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221296X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221297X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Llácer JL., Espinosa J., Castells MA., Contreras A., Forchhammer K., Rubio V. DIP original experiment: DIP-221295X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for the regulation of NtcA-dependent transcription by proteins PipX and PII. glnb_syne7 Nitrogen regulatory protein P-II PII signal transducing protein glnB Synpcc7942_0321 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI DIP protein P0A3F4 original sequence version: 31 DIP protein P0A3F4 original sequence version: 57 DIP protein P0A3F4 original sequence version: 52 5F44B64CBFF3C559 argb_syne7 Acetylglutamate kinase NAG kinase N-acetyl-L-glutamate 5-phosphotransferase argB Synpcc7942_1496 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSSEFIEAGAADRVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQEGIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAEKLILLTDTRGILEDPKRPESLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALLLEIFTDAGIGTMIVGSGYHEAHQPWQ DIP protein Q6V1L5 original sequence version: 32 DIP protein Q6V1L5 original sequence version: 55 DIP protein Q6V1L5 original sequence version: 50 0652E306DEB1947B q7x386_syne7 Synpcc7942_2061 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MASENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL DIP protein Q7X386 original sequence version: 37 314A9A0BA1F3E2D2 ntca_syne7 Global nitrogen regulator ntcA Synpcc7942_0127 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLANENSLLTMFRELGSGKLPLQIEQFERGKTIFFPGDPAERVYLLVKGAVKLSRVYESGEEITVALLRENSVFGVLSLLTGQRSDRFYHAVAFTPVQLFSVPIEFMQKALIERPELANVMLQGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGIPSPDGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLRESKLIAIHKKRITVFNPVALSQQFS DIP protein P29283 original sequence version: 71 ntca-2 5 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q7x386_syne7-glnb-1 6 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ntca-q7x386_syne7-1 12 17 unspecified role unspecified role bait bait ecolx Escherichia coli 16 unspecified role unspecified role prey prey Q7X386:p.Tyr32Ala Y32A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y32A'. Wed May 02 20:06:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr32ala' Tue Jun 30 19:58:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr32Ala' Q7X386:p.Tyr6Ala Y6A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y6A'. Wed May 02 18:57:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr6ala' Tue Jun 30 15:34:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr6Ala' Q7X386:p.Phe12Ala F12A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F12A'. Wed May 02 18:41:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe12ala' Tue Jun 30 17:58:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe12Ala' ecolx Escherichia coli direct interaction direct interaction ntca-q7x386_syne7-2 7 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction glnb-q7x386_syne7-1 1 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q7x386_syne7-ntca-1 4 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction q7x386_syne7-glnb-2 13 14 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction q7x386_syne7-glnb-3 2 14 unspecified role unspecified role prey prey P0A3F4:p.Phe11Ala F11A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F11A'. Wed May 02 18:16:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe11ala' Tue Jun 30 19:21:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe11Ala' P0A3F4:p.Glu32Ala E32A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E32A'. Wed May 02 17:08:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu32ala' Tue Jun 30 19:49:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu32Ala' P0A3F4:p.Arg45Ala R45A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R45A'. Wed May 02 18:36:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg45ala' Tue Jun 30 20:14:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg45Ala' P0A3F4:p.Tyr46Ala Y46A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y46A'. Wed May 02 20:33:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr46ala' Tue Jun 30 16:33:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr46Ala' ecolx Escherichia coli 16 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction glnb-glnb-8 8 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction glnb-q7x386_syne7-2 11 14 unspecified role unspecified role bait bait ecolx Escherichia coli 16 unspecified role unspecified role prey prey Q7X386:p.Tyr32Ala Y32A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y32A'. Wed May 02 15:21:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr32ala' Tue Jun 30 20:15:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr32Ala' Q7X386:p.Glu4Ala E4A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E4A'. Wed May 02 18:03:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu4ala' Tue Jun 30 15:40:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu4Ala' Q7X386:p.Tyr6Ala Y6A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y6A'. Wed May 02 17:25:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr6ala' Tue Jun 30 17:23:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr6Ala' Q7X386:p.Phe12Ala F12A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F12A'. Wed May 02 18:36:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe12ala' Tue Jun 30 18:52:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe12Ala' ecolx Escherichia coli direct interaction direct interaction glnb-q7x386_syne7-3 9 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction q7x386_syne7-q7x386_syne7-1 10 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role ancillary ancillary yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association glnb-argb-8 3 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction