DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Trimethylguanosine capping selectively promotes expression of Rev-dependent HIV-1 RNAs. Trimethylguanosine capping selectively promotes expression of Rev-dependent HIV-1 RNAs. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Yedavalli VS., Jeang KT. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yedavalli VS., Jeang KT. DIP original experiment: DIP-219928X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Trimethylguanosine capping selectively promotes expression of Rev-dependent HIV-1 RNAs. tgs1_human Trimethylguanosine synthase Cap-specific guanine-N2 methyltransferase Nuclear receptor coactivator 6-interacting protein PRIP-interacting protein with methyltransferase motif CLL-associated antigen KW-2 Hepatocellular carcinoma-associated antigen 137 TGS1 PIMT HCA137 NCOA6IP protein protein human Homo sapiens Human MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCGTAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQESWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLLWQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSEVSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHKPSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKMKNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGDDLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKKVNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET DIP protein Q96RS0 original sequence version: 136 DIP protein Q96RS0 original sequence version: 80 FF670AFBE0979443 rev_hv1h2 Protein Rev rev ART/TRS Anti-repression transactivator Regulator of expression of viral proteins protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE DIP protein P04618 original sequence version: 105 DIP protein P04618 original sequence version: 107 4BCF5059C9A7F3B2 tgs1-rev-1 1 3 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 2 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association