DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219895X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219898X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219897X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219896X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219899X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219893X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219894X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. morc1_arath Protein MICRORCHIDIA 1 MORC1 CRT1 Protein COMPROMISED RECOGNITION OF TCV 1 C7A10.1020 F23E13.180 At4g36290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKNYTVADVVNIDSDSDSDDDNGGVIGMVPSLASLIENQKVSIADAATVAPRETLECRSFWKAGENFVIPSSVTLTAIGMVEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEIQNGATVVKIDKINIVKDNTPALVFQDNGGGMDPNGIRKCMSLGYSSKKSNTTIGQYGNGFKTSTMRLGADAMVFSRSTRGGKSTQSIGLLSYTFLRKTGQDDVIVPMIDFDISSDSPQPIIYGSPGDWSTNLNILLKWSPFSTMVELLQQFEDIGTHGTKVIIYNLWLNDEGIYELSFDDDDVDIRLRDENAQDGKRLHAKTLEVRSHISYRYRHSLRAYISMLYLKKFKNFKIILRGVSVAQFNIADEFRHPETIMYKPQAAAVDYAATGIKVGFIKEAPKLPICGFNVYHKNRLIRPFWKVVLEGSTRGNGVMGVLEANFIEPAHDKQDFERSSLFLRLEARLKRITSDYWQNHCHIFGYQTAQIPADKSKRTVIPDQPPTVNTYNPSPLPSDRISHGGPIIREINLSNATSSRTAAVAAPHLRNYTGLRNNFQPVQLNPQPPAAGDTGNNLVGKLAAEIREENLQLFMRCEEYVKKENEVEQTVKSLEKELEEIKSKCAQLALLVDAKKKEMQQV DIP protein Q84WV6 original sequence version: 51 0889A04DBCFBAB8D bh063_arath Transcription factor bHLH63 BHLH63 EN84 Basic helix-loop-helix protein 63 Transcription factor EN 84 bHLH transcription factor bHLH063 T4L20.110 At4g34530 CIB1 Protein CRYPTOCHROME INTERACTING BASIC-HELIX-LOOP-HELIX 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPSMWDSHVQNLYGNLGV DIP protein Q8GY61 original sequence version: 62 DIP protein Q8GY61 original sequence version: 71 05F0CA14FC2B3C7A cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA DIP protein P43254 original sequence version: 138 DIP protein P43254 original sequence version: 113 DIP protein P43254 original sequence version: 114 E6D9A1B702EAE8F0 cry2_arath Cryptochrome-2 Blue light photoreceptor CRY2 PHH1 Protein PHR homolog 1 Protein SUPPRESSOR OF elf3 20 SEL20 F19P19.14 At1g04400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGSKRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSDQITTSLGKNGCK DIP protein Q96524 original sequence version: 123 DIP protein Q96524 original sequence version: 101 DIP protein Q96524 original sequence version: 110 082E311301465904 phot2_arath Phototropin-2 PHOT2 CAV1 KIN7 NPL1 Defective in chloroplast avoidance protein 1 Non-phototropic hypocotyl 1-like protein 1 K21L19.6 At5g58140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERPRAPPSPLNDAESLSERRSLEIFNPSSGKETHGSTSSSSKPPLDGNNKGSSSKWMEFQDSAKITERTAEWGLSAVKPDSGDDGISFKLSSEVERSKNMSRRSSEESTSSESGAFPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALDSITEVVQTIRHRKSQVQESVSNDTMVKPDSSTTPTPGRQTRQSDEASKSFRTPGRVSTPTGSKLKSSNNRHEDLLRMEPEELMLSTEVIGQRDSWDLSDRERDIRQGIDLATTLERIEKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLVKATATNVDEAVRELPDANTRPEDLWAAHSKPVYPLPHNKESTSWKAIKKIQASGETVGLHHFKPIKPLGSGDTGSVHLVELKGTGELYAMKAMEKTMMLNRNKAHRACIEREIISLLDHPFLPTLYASFQTSTHVCLITDFCPGGELFALLDRQPMKILTEDSARFYAAEVVIGLEYLHCLGIVYRDLKPENILLKKDGHIVLADFDLSFMTTCTPQLIIPAAPSKRRRSKSQPLPTFVAEPSTQSNSFVGTEEYIAPEIITGAGHTSAIDWWALGILLYEMLYGRTPFRGKNRQKTFANILHKDLTFPSSIPVSLVGRQLINTLLNRDPSSRLGSKGGANEIKQHAFFRGINWPLIRGMSPPPLDAPLSIIEKDPNAKDIKWEDDGVLVNSTDLDIDLF DIP protein P93025 original sequence version: 98 CA163E2596289737 rpp8_arath Disease resistance protein RPP8 RPP8 HRT Resistance to Peronospora parasitica protein 8 MWF20.19 At5g43470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ DIP protein Q8W4J9 original sequence version: 78 bhlh63-cry2-1 1 9 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 11 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana direct interaction direct interaction cop1-rpp8-1 6 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association morc1-rpp8-1 5 8 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 13 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana direct interaction direct interaction cop1-rpp8-2 3 13 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana direct interaction direct interaction cop1-cry2-1 4 10 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 11 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana direct interaction direct interaction cop1-phot2-1 7 12 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range nicbe Nicotiana benthamiana physical association physical association cop1-phot2-2 2 12 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana 10 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nicbe Nicotiana benthamiana direct interaction direct interaction