DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218331X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218330X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218332X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218336X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218337X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218335X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218333X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Nature structural & molecular biology 2010 imex curation Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218334X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. dpmfklv Activator peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DPMFKLV degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ DIP protein P0C0V0 original sequence version: 94 DIP protein P0C0V0 original sequence version: 75 DIP protein P0C0V0 original sequence version: 62 DIP protein P0C0V0 original sequence version: 84 DIP protein P0C0V0 original sequence version: 67 5482E596F74B6D5F casb_bovin Beta-casein CSN2 protein protein bovin Bos taurus (Bovine) Bovine MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV DIP protein P02666 original sequence version: 88 DIP protein P02666 original sequence version: 101 F0BBDD8148A238AE dnrdgnvyff Activator peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DNRDGNVYFF csn2-degp-6 8 11 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 10 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage degp-11 2 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction degp-dnrdgnvyff-1 1 12 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction degp-dpmfklv-1 5 9 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Phe266Ala F266A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F266A'. Wed May 02 17:51:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe266ala' Tue Jun 30 18:21:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe266Ala' P0C0V0:p.[Arg288Ala;Val354Ser] R288A/V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V S certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R288A/V354S'. Wed May 02 16:55:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg288ala,val354ser' Tue Jun 30 20:08:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg288Ala;Val354Ser]' P0C0V0:p.Glu222Ala E222A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E222A'. Wed May 02 15:57:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu222ala' Tue Jun 30 18:11:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu222Ala' P0C0V0:p.Phe224Ala F224A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F224A'. Wed May 02 15:35:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe224ala' Tue Jun 30 17:43:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe224Ala' ecolx Escherichia coli direct interaction direct interaction degp-dnrdgnvyff-2 6 12 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction degp-dpmfklv-2 3 9 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Arg288Ala R288A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R288A'. Wed May 02 15:54:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg288ala' Tue Jun 30 19:50:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg288Ala' P0C0V0:p.Val354Ser V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V S This feature has been corrected as a result of our quality control procedures. The original label was 'V354S'. Wed May 02 17:53:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val354ser' Tue Jun 30 19:34:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val354Ser' P0C0V0:p.[Arg288Ala;Val354Ser] R288A/V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V S certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R288A/V354S'. Wed May 02 17:41:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg288ala,val354ser' Tue Jun 30 16:04:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg288Ala;Val354Ser]' P0C0V0:p.Leu291Asn L291N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L N This feature has been corrected as a result of our quality control procedures. The original label was 'L291N'. Wed May 02 20:02:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu291asn' Tue Jun 30 19:09:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu291Asn' P0C0V0:p.Leu350Asn L350N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L N This feature has been corrected as a result of our quality control procedures. The original label was 'L350N'. Wed May 02 16:03:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu350asn' Tue Jun 30 19:28:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu350Asn' P0C0V0:p.Arg213Ala R213A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R213A'. Wed May 02 17:01:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg213ala' Tue Jun 30 19:33:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg213Ala' P0C0V0:p.Leu216Ala L216A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L216A'. Wed May 02 17:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu216ala' Tue Jun 30 17:14:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu216Ala' P0C0V0:p.Glu222Ala E222A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E222A'. Wed May 02 17:00:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu222ala' Tue Jun 30 17:09:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu222Ala' P0C0V0:p.Phe224Ala F224A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F224A'. Wed May 02 16:16:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe224ala' Tue Jun 30 17:38:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe224Ala' P0C0V0:p.Leu255Ala L255A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L255A'. Wed May 02 15:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu255ala' Tue Jun 30 19:56:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu255Ala' P0C0V0:p.Ile264Ala I264A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I264A'. Wed May 02 18:51:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile264ala' Tue Jun 30 18:11:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile264Ala' P0C0V0:p.Phe266Ala F266A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F266A'. Wed May 02 15:13:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe266ala' Tue Jun 30 18:23:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe266Ala' ecolx Escherichia coli direct interaction direct interaction csn2-degp-7 7 11 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csn2-degp-8 4 11 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 10 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction