DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217539X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217543X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217549X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217553X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217547X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217551X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217544X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217548X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217552X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217545X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217535X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217541X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217537X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217538X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217542X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217546X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217550X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217534X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217536X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. Nature structural & molecular biology 2010 imex curation El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western El Messaoudi-Aubert S., Nicholls J., Maertens GN., Brookes S., Bernstein E., Peters G. DIP original experiment: DIP-217540X Nature structural & molecular biology 2010 IMEx Role for the MOV10 RNA helicase in polycomb-mediated repression of the INK4a tumor suppressor. mov10_human Helicase MOV-10 Moloney leukemia virus 10 protein MOV10 KIAA1631 Armitage homolog protein protein human Homo sapiens Human MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRAKGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNEL DIP protein Q9HCE1 original sequence version: 55 DIP protein Q9HCE1 original sequence version: 74 28A8B3BF9B5B54FC cbx8_human Chromobox protein homolog 8 Polycomb 3 homolog Rectachrome 1 CBX8 PC3 RC1 protein protein human Homo sapiens Human MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR DIP protein Q9HC52 original sequence version: 81 DIP protein Q9HC52 original sequence version: 80 DIP protein Q9HC52 original sequence version: 102 DIP protein Q9HC52 original sequence version: 107 651263C85B0ECD93 eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein O75530 original sequence version: 70 DIP protein O75530-1 original sequence version: 78 DIP protein O75530 original sequence version: 78 DIP protein O75530 original sequence version: 73 DIP protein O75530-1 original sequence version: 89 DIP protein O75530-1 original sequence version: 87 DIP protein O75530 original sequence version: 77 D2E0A5BA27C0499A dcaf7_human DDB1- and CUL4-associated factor 7 DCAF7 HAN11 WD repeat-containing protein An11 homolog WDR68 WD repeat-containing protein 68 protein protein human Homo sapiens Human MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV DIP protein P61962 original sequence version: 141 DIP protein P61962 original sequence version: 70 DIP protein P61962 original sequence version: 117 794CC69A45D0CC7C cbx6_human Chromobox protein homolog 6 CBX6 protein protein human Homo sapiens Human MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK DIP protein O95503 original sequence version: 80 phc2_human Polyhomeotic-like protein 2 Early development regulatory protein 2 PHC2 EDR2 PH2 protein protein human Homo sapiens Human MENELPVPHTSSSACATSSTSGASSSSGCNNSSSGGSGRPTGPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVSNRQGSTSGSNVSAQAPAQSSSINLAASPAAAQLLNRAQSVNSAAASGIAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELGTGSPARPPTPAQVQNLTLRTQQTPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQSRNTAQASPAGAKPGIADSVMEPHKKGDGNSSVPGSMEGRAGLSRTVPAVAAHPLIAPAYAQLQPHQLLPQPSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQRRFQHTSAVILQLQPASPPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQAIVTAMPGGLPVPTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS DIP protein Q8IXK0 original sequence version: 67 2E3FD3898CFD702B ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q99496 original sequence version: 95 DIP protein Q99496 original sequence version: 94 DIP protein Q99496 original sequence version: 96 DIP protein Q99496 original sequence version: 125 DIP protein Q99496 original sequence version: 142 DIP protein Q99496 original sequence version: 159 DIP protein Q99496 original sequence version: 129 DIP protein Q99496 original sequence version: 99 DIP protein Q99496 original sequence version: 118 90EA546E1F4DB7EC hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD P0DMV8,P0DMV9 pkhl1_human Fibrocystin-L PKHD1L1 Polycystic kidney and hepatic disease 1-like protein 1 protein protein human Homo sapiens Human MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSINGATRLTIRGEGFSQANQFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYTRAMPEDSYTVRVSVDGVPVTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIALSSNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMVCKTTGTFIGHHNVSFILDNDYGRSFPQKMAYFVSSLNKIAMFQTYAEVTMIFPSQGSIRGGTTLTISGRFFDQTDFPVRVLVGGEPCDILNVTENSICCKTPPKPHILKTVYPGGRGLKLEVWNNSRPIRLEEILEYNEKTPGYMGASWVDSASYIWLMEQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQTGLPEDKVRIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQYRNVYTEQQTGDAVNEEQVIKSQSTILQEVQVITLENWETTNAINEVQKIKVTSPCVEANSCSLYQYRLIYNMEKTVFLPADASEFILQSALNDLWSIKPDTVQVIRTQNPQSYVYMVTFISTRGDFDLLGYEVVEGNNVTLDITEQTKGKPNLETFTLNWDGIASKPLTLWSSEAEFQGAVEEMVSTKCPPQIANFEEGFVVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPAVLFDSADVKPNRRPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDNSKITRSTDTQFTYNFAYGNNWTYTCIDLLDLVRTKYTGTNVSLQRISLHKASESQSFYVDVVYIGHTSTISTLDEMPKRRLPALANKGIFLEHFQVNQTKTNGPTMTNQYSVTMTSYNCSYNIPMMAVSFGQIITHETENEFVYRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGHILKGLPAAVSAADLQFALQSLEGMGRISVTREGTCAGYAWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKEGGLFRQHVLGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSNITPLVLAISPSQGSYEEGTILTIVGSGFSPSSAVTVSVGPVGCSLLSVDEKELKCQILNGSAGHAPVAVSMADVGLAQNVGGEEFYFVYQSQISHIWPDSGSIAGGTLLTLSGFGFNENSKVLVGNETCNVIEGDLNRITCRTPKKTEGTVDISVTTNGFQATARDAFSYNCLQTPIITDFSPKVRTILGEVNLTIKGYNFGNELTQNMAVYVGGKTCQILHWNFTDIRCLLPKLSPGKHDIYVEVRNWGFASTRDKLNSSIQYVLEVTSMFPQRGSLFGGTEITIRGFGFSTIPAENTVLLGSIPCNVTSSSENVIKCILHSTGNIFRITNNGKDSVHGLGYAWSPPVLNVSVGDTVAWHWQTHPFLRGIGYRIFSVSSPGSVIYDGKGFTSGRQKSTSGSFSYQFTSPGIHYYSSGYVDEAHSIFLQGVINVLPAETRHIPLHLFVGRSEATYAYGGPENLHLGSSVAGCLATEPLCSLNNTRVKNSKRLLFEVSSCFSPSISNITPSTGTVNELITIIGHGFSNLPWANKVTIGSYPCVVEESSEDSITCHIDPQNSMDVGIRETVTLTVYNLGTAINTLSNEFDRRFVLLPNIDLVLPNAGSTTGMTSVTIKGSGFAVSSAGVKVLMGHFPCKVLSVNYTAIECETSPAAQQLVDVDLLIHGVPAQCQGNCTFSYLESITPYITGVFPNSVIGSVKVLIEGEGLGTVLEDIAVFIGNQQFRAIEVNENNITALVTPLPVGHHSVSVVVGSKGLALGNLTVSSPPVASLSPTSGSIGGGTTLVITGNGFYPGNTTVTIGDEPCQIISINPNEVYCRTPAGTTGMVDVKIFVNTIAYPPLLFTYALEDTPFLRGIIPSRGPPGTEIEITGSNFGFEILEISVMINNIQCNVTMANDSVVQCIVGDHAGGTFPVMMHHKTKGSAMSTVVFEYPLNIQNINPSQGSFGGGQTMTVTGTGFNPQNSIILVCGSECAIDRLRSDYTTLLCEIPSNNGTGAEQACEVSVVNGKDLSQSMTPFTYAVSLTPLITAVSPKRGSTAGGTRLTVVGSGFSENMEDVHITIAEAKCDVEYSNKTHIICMTDAHTLSGWAPVCVHIRGVGMAKLDNADFLYVDAWSSNFSWGGKSPPEEGSLVVITKGQTILLDQSTPILKMLLIQGGTLIFDEADIELQAENILITDGGVLQIGTETSPFQHKAVITLHGHLRSPELPVYGAKTLAVREGILDLHGVPVPVTWTRLAHTAKAGERILILQEAVTWKPGDNIVIASTGHRHSQGENEKMTIASVSADGINITLSNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNVEWNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCVMFHAPVPGANMVTGRIEYVEVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYDIKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAVAGGTHFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTSTVPAPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETNGAVIKNAKIVGHLDELGMGSAFCTAKGLVLPFSEGLTVSSVHFMNFDRPNCVALGVTSISGVCNDRCGGWSAKFVDVQYSHTPNKAGFRWEHEMVMIDVDGSLTGHKGHTVIPHSSLLDPSHCTQEAEWSIGFPGSVCDASVSFHRLAFNQPSPVSLLEKDVVLSDSFGTSIIPFQKKRLTHMSGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKEEDYVIISHNFTQNPDMFNIIDMRNGSSNPLNWNTSKNGDWHLEANTSTLYYLVSGRNDLHQSQLISGNLDPDVKDVVINFQAYCCILQDCFPVHPPSRKPIPKKRPATYNLWSNDSFWQSSRENNYTVPHPGANVIIPEGTWIVADIDMPSMERLIIWGVLELEDKYNVGAAESSYREVVLNATYISLQGGRLIGGWEDNPFKGDLKIVLRGNHTTQDWALPEGPNQGAKVLGVFGELDLHGIPHSIYKTKLSETAFAGSKVLSLMDAVDWQEGEEIVITTTSYDFHQTETRSIVKILHDHKILILNDSLSYTHFAEKYHVPGTGESYTLAADVGILSRNIKIVGEDYPGWSEDSFGARVLVGSFTENMMTFKGNARISNVEFYHSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIRGCAFHHGFSPAIGVFGTDGLDIDDNIIHFTVGEGIRIWGNANRVRGNLIALSVWPGTYQNRKDLSSTLWHAAIEINRGTNTVLQNNVVAGFGRAGYRIDGEPCPGQFNPVEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFTIWTCWDYGIYFQTTESVHIYNVTLVDNGMAIFPMIYMPAAISHKISSKNVQIKSSLIVGSSPGFNCSDVLTNDDPNIELTAAHRSPRSPSGGRSGICWPTFASAHNMAPRKPHAGIMSYNAISGLLDISGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIKLVDTTEQSKIFIHRPDISKVNPSDCVDMVCDAKRKSFLRDIDGSFLGNAGSVIPQAEYEWDGNSQVGIGDYRIPKAMLTFLNGSRIPVTEKAPHKGIIRDSTCKYLPEWQSYQCFGMEYAMMVIESLDPDTETRRLSPVAIMGNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEVYFTGTSPQNLRLMLLNVDHNKAVLVGIFFSTLQRLDVYVNNLLVCPKTTIWNAQQKHCELNNHLYKDQFLPNLDSTVLGENYFDGTYQMLYLLVKGTIPVEIHTATVIFVSFQLSVATEDDFYTSHNLVKNLALFLKIPSDKIRISKIRGKSLRRKRSMGFIIEIEIGDPPIQFISNGTTGQMQLSELQEIAGSLGQAVILGNISSILGFNISSMSITNPLPSPSDSGWIKVTAQPVERSAFPVHHVAFVSSLLVITQPVAAQPGQPFPQQPSVKATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSGNTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVGVESRTFSLLAESVSSSGSSSSSNSKASTVGTYAQIMTVVISCLVGRMWLLEIFMAAVSTLNITLRSY DIP protein Q86WI1 original sequence version: 49 csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR DIP protein P67870 original sequence version: 77 DIP protein P67870 original sequence version: 124 DIP protein P67870 original sequence version: 134 E465B1E699B0E0EC pcgf2_human Polycomb group RING finger protein 2 PCGF2 MEL18 RNF110 ZNF144 DNA-binding protein Mel-18 RING finger protein 110 Zinc finger protein 144 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT DIP protein P35227 original sequence version: 96 DIP protein P35227 original sequence version: 124 A910BCD4C0CE9927 ring1_human E3 ubiquitin-protein ligase RING1 RING finger protein 1 Polycomb complex protein RING1 RING1 RNF1 Really interesting new gene 1 protein RING-type E3 ubiquitin transferase RING1 protein protein human Homo sapiens Human MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK DIP protein Q06587 original sequence version: 103 DIP protein Q06587 original sequence version: 147 DIP protein Q06587 original sequence version: 135 6959787479DE9DAB fibrosin1 Fibrosin-1 protein protein human Homo sapiens Human This sequence has been withdrawn from Uniprot. The sequence has been withdrawn from uniprot. pcgf6_human Polycomb group RING finger protein 6 RING finger protein 134 Mel18 and Bmi1-like RING finger PCGF6 MBLR RNF134 protein protein human Homo sapiens Human MEGVAVVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT DIP protein Q9BYE7 original sequence version: 81 DIP protein Q9BYE7 original sequence version: 123 05977FE6F14972DE ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 cbx7_human Chromobox protein homolog 7 CBX7 protein protein human Homo sapiens Human MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF DIP protein O95931 original sequence version: 81 DIP protein O95931 original sequence version: 82 DIP protein O95931 original sequence version: 108 A90019C1D08812B8 bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL DIP protein P11021 original sequence version: 127 DIP protein P11021 original sequence version: 137 DIP protein P11021 original sequence version: 185 59B7D8D85BC32A00 suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 if2b1_human Insulin-like growth factor 2 mRNA-binding protein 1 ZBP1 IGF-II mRNA-binding protein 1 Coding region determinant-binding protein VICKZ family member 1 IGF2BP1 Zipcode-binding protein 1 CRDBP VICKZ1 protein protein human Homo sapiens Human MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK DIP protein Q9NZI8 original sequence version: 77 1D036AE5388D05FA csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG DIP protein P35226 original sequence version: 105 DIP protein P35226 original sequence version: 136 DIP protein P35226 original sequence version: 110 DIP protein P35226 original sequence version: 129 030A7D396BADA543 cbx7_mouse Chromobox protein homolog 7 Cbx7 D15Ertd417e protein protein mouse Mus musculus Mouse MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL DIP protein Q8VDS3 original sequence version: 58 A40021F05B16BEAF cbx8-mov10-1 1 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cbx7-mov10-1 8 42 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction mov10-cbx7-1 18 36 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association mov10-bmi1-1 2 31 unspecified role unspecified role prey prey human Homo sapiens Human 41 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human association association eed-suz12-2 5 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 38 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cbx7-mov10-2 11 36 unspecified role unspecified role bait bait human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association mov10-rnf2-1 7 27 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cbx8-1 6 22 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association mov10-cbx7-2 3 32 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human association association cbx7-mov10-3 20 36 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cbx7-mov10-4 19 42 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association bmi1-cbx7-5 9 27 unspecified role unspecified role prey prey human Homo sapiens Human 41 unspecified role unspecified role bait bait human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 36 unspecified role unspecified role prey prey human Homo sapiens Human association association bmi1-mov10-1 12 41 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cbx7-igf2bp1-1 13 39 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cbx7-mov10-5 10 42 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association cbx7-csnk2a1-1 4 40 unspecified role unspecified role prey prey human Homo sapiens Human 30 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 32 unspecified role unspecified role prey prey human Homo sapiens Human 39 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 34 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role prey prey human Homo sapiens Human 37 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human association association igf2bp1-mov10-1 14 39 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association pcgf2-mov10-1 15 31 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ezh2-suz12-6 16 38 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cbx6-mov10-1 17 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association