DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217506X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217507X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217502X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217503X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217500X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217504X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217508X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217501X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217509X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. Nature structural & molecular biology 2010 imex curation le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined le Maire A., Teyssier C., Erb C., Grimaldi M., Alvarez S., de Lera AR., Balaguer P., Gronemeyer H., Royer CA., Germain P., Bourguet W. DIP original experiment: DIP-217505X Nature structural & molecular biology 2010 IMEx A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor. ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein Q60974 original sequence version: 149 DIP protein Q60974 original sequence version: 144 DIP protein Q60974 original sequence version: 110 DIP protein Q60974 original sequence version: 92 DIP protein Q60974-1 original sequence version: 110 DIP protein Q60974 original sequence version: 161 DIP protein Q60974 original sequence version: 131 52208B40382F7E6A rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 ncoa2_human Nuclear receptor coactivator 2 NCOA2 TIF2 Transcriptional intermediary factor 2 BHLHE75 Class E basic helix-loop-helix protein 75 SRC2 protein protein human Homo sapiens Human MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC DIP protein Q15596 original sequence version: 91 DIP protein Q15596 original sequence version: 116 DIP protein Q15596 original sequence version: 155 DIP protein Q15596 original sequence version: 136 DIP protein Q15596 original sequence version: 125 0A61AA5D1878304B ncoa1_human Nuclear receptor coactivator 1 Steroid receptor coactivator 1 RIP160 Protein Hin-2 Renal carcinoma antigen NY-REN-52 NCOA1 SRC1 BHLHE74 Class E basic helix-loop-helix protein 74 protein protein human Homo sapiens Human MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINRQQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE DIP protein Q15788-1 original sequence version: 60 DIP protein Q15788-1 original sequence version: 62 DIP protein Q15788 original sequence version: 88 DIP protein Q15788 original sequence version: 107 DIP protein Q15788 original sequence version: 96 25EF6F389489121E ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE DIP protein Q9Y618 original sequence version: 166 DIP protein Q9Y618-1 original sequence version: 119 DIP protein Q9Y618-1 original sequence version: 155 DIP protein Q9Y618 original sequence version: 134 DIP protein Q9Y618 original sequence version: 138 70A89C9A19612AAD ncor1_human Nuclear receptor corepressor 1 NCOR1 KIAA1047 protein protein human Homo sapiens Human MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDEKEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESVETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDNTKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPKPSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQEGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKGREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKAGETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMNRTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVYRSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITYIPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPAGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPASSPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIPGQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein O75376 original sequence version: 186 DIP protein O75376 original sequence version: 75 DIP protein O75376 original sequence version: 153 DIP protein O75376 original sequence version: 147 DIP protein O75376 original sequence version: 112 DIP protein O75376-1 original sequence version: 111 DIP protein O75376 original sequence version: 146 1647FE060373A125 ncor1-rara-1 3 16 unspecified role unspecified role unspecified role unspecified role NR1 domain Region 2047-2065 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NR2 domain Region 2256-2276 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P10276:p.Ile396Glu I396E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I396E'. Wed May 02 16:52:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile396glu' Tue Jun 30 17:35:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile396Glu' ecolx Escherichia coli direct interaction direct interaction ncoa1-rara-1 5 14 unspecified role unspecified role unspecified role unspecified role NR2 domain Region 686-698 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ncor1-rara-3 7 11 unspecified role unspecified role bait bait ID1-2 domain Region 1629-2453 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 12 unspecified role unspecified role prey prey Ligand-binding domain Region 176-403 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P10276:p.Ile396Glu I396E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I396E'. Wed May 02 14:29:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile396glu' Tue Jun 30 19:23:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile396Glu' human Homo sapiens Human direct interaction direct interaction ncor2-rara-1 2 15 unspecified role unspecified role bait bait ID1-2 domain Region 982-2525 binding region binding-associated region binding region certain certain sequence position certain c-term range C-terminal range c-term range [EBI-15860559]The shifted ranges (982-2514) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-15860559]982-2514 [EBI-15860559]Q9Y618,2 Q9Y618:p.[Val2139Ala;Ile2140Ala] V2150A/I2151A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V2150A/I2151A'. Wed May 02 18:18:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val2150ala,ile2151ala' Wed Sep 26 14:31:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val2150Ala;Ile2151Ala]' Tue Jun 30 16:14:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val2139Ala;Ile2140Ala]' Q9Y618:p.[Ile2342Ala;Ile2343Ala] I2353A/I2354A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I2353A/I2354A'. Wed May 02 20:20:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile2353ala,ile2354ala' Wed Sep 26 10:49:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile2353Ala;Ile2354Ala]' Tue Jun 30 19:52:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile2342Ala;Ile2343Ala]' Q9Y618:p.Arg2128Ala R2139A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R2139A'. Wed May 02 17:44:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg2139ala' Wed Sep 26 13:09:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg2139Ala' Tue Jun 30 19:32:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg2128Ala' Q9Y618:p.Val2130Pro V2141P mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V P This feature has been corrected as a result of our quality control procedures. The original label was 'V2141P'. Wed May 02 16:41:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val2141pro' Wed Sep 26 13:06:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val2141Pro' Tue Jun 30 18:52:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val2130Pro' Q9Y618:p.Thr2131Gly T2142G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T G This feature has been corrected as a result of our quality control procedures. The original label was 'T2142G'. Wed May 02 19:13:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr2142gly' Wed Sep 26 10:42:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr2142Gly' Tue Jun 30 20:24:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr2131Gly' human Homo sapiens Human 12 unspecified role unspecified role prey prey Ligand-binding domain Region 176-403 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P10276:p.Ile396Glu I396E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I396E'. Wed May 02 17:38:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile396glu' Tue Jun 30 15:37:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile396Glu' human Homo sapiens Human physical association physical association 2b,c ncor2-rara-2 6 15 unspecified role unspecified role unspecified role unspecified role NR1 domain Region 2139-2157 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tetramethylrhodamine-label Tetramethylrhodamine-label fluorescent dye fluorescent dye label fluorescent dye n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P10276:p.Ile396Glu I396E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I396E'. Wed May 02 15:36:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile396glu' Tue Jun 30 17:56:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile396Glu' ecolx Escherichia coli direct interaction direct interaction ncor1-rara-4 8 16 unspecified role unspecified role unspecified role unspecified role NR1 domain Region 2047-2065 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ncoa1-rara-2 1 14 unspecified role unspecified role unspecified role unspecified role NR2 domain Region 686-698 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ncoa2-rara-1 9 13 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 12 unspecified role unspecified role prey prey Ligand-binding domain Region 176-403 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction ncor1-rara-5 4 16 unspecified role unspecified role unspecified role unspecified role NR2 domain Region 2051-2065 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ncor2-rara-3 10 15 unspecified role unspecified role unspecified role unspecified role NR2 domain Region 2346-2367 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role unspecified role unspecified role Ligand-binding domain Region 176-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P10276:p.Ile396Glu I396E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E This feature has been corrected as a result of our quality control procedures. The original label was 'I396E'. Wed May 02 15:43:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile396glu' Tue Jun 30 17:35:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile396Glu' ecolx Escherichia coli direct interaction direct interaction