DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of HIV-1 Tat complexed with human P-TEFb. Crystal structure of HIV-1 Tat complexed with human P-TEFb. Nature 2010 imex curation Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. DIP original experiment: DIP-220730X Nature 2010 IMEx Crystal structure of HIV-1 Tat complexed with human P-TEFb. Crystal structure of HIV-1 Tat complexed with human P-TEFb. Crystal structure of HIV-1 Tat complexed with human P-TEFb. Nature 2010 imex curation Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. DIP original experiment: DIP-220731X Nature 2010 IMEx Crystal structure of HIV-1 Tat complexed with human P-TEFb. Crystal structure of HIV-1 Tat complexed with human P-TEFb. Crystal structure of HIV-1 Tat complexed with human P-TEFb. Nature 2010 imex curation Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Tahirov TH., Babayeva ND., Varzavand K., Cooper JJ., Sedore SC., Price DH. DIP original experiment: DIP-220729X Nature 2010 IMEx Crystal structure of HIV-1 Tat complexed with human P-TEFb. tat_hv1h2 Protein Tat tat Transactivating regulatory protein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE 4DDC56D979769115 4DDC56D979769115 cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein P50750 original sequence version: 100 DIP protein P50750 original sequence version: 115 DIP protein P50750-1 original sequence version: 119 DIP protein P50750 original sequence version: 170 DIP protein P50750 original sequence version: 184 DIP protein P50750-1 original sequence version: 144 DIP protein P50750 original sequence version: 70 DIP protein P50750 original sequence version: 120 69E851CC6F7A0388 ccnt1_human Cyclin-T1 CCNT1 protein protein human Homo sapiens Human MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPPLPPLPK DIP protein O60563 original sequence version: 85 DIP protein O60563 original sequence version: 79 DIP protein O60563 original sequence version: 98 DIP protein O60563 original sequence version: 102 DIP protein O60563 original sequence version: 164 DIP protein O60563 original sequence version: 125 DIP protein O60563 original sequence version: 103 4637EFB2DDEDFE13 cdk9-ccnt1-2 3 4 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role prey prey Region 1-266 Region 1-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role bait bait Kinase domain Region 1-345 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association ccnt1-cdk9-6 2 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role Region 1-266 Region 1-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role unspecified role unspecified role Kinase domain Region 1-345 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association ccnt1-cdk9-7 1 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role Region 1-266 Region 1-266 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role unspecified role unspecified role Kinase domain Region 1-345 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction