DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Cho Y., Crichlow GV., Vermeire JJ., Leng L., Du X., Hodsdon ME., Bucala R., Cappello M., Gross M., Gaeta F., Johnson K., Lolis EJ. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Cho Y., Crichlow GV., Vermeire JJ., Leng L., Du X., Hodsdon ME., Bucala R., Cappello M., Gross M., Gaeta F., Johnson K., Lolis EJ. DIP original experiment: DIP-219835X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Cho Y., Crichlow GV., Vermeire JJ., Leng L., Du X., Hodsdon ME., Bucala R., Cappello M., Gross M., Gaeta F., Johnson K., Lolis EJ. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cho Y., Crichlow GV., Vermeire JJ., Leng L., Du X., Hodsdon ME., Bucala R., Cappello M., Gross M., Gaeta F., Johnson K., Lolis EJ. DIP original experiment: DIP-219836X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Allosteric inhibition of macrophage migration inhibitory factor revealed by ibudilast. mif_human Macrophage migration inhibitory factor MIF MMIF GLIF Phenylpyruvate tautomerase Glycosylation-inhibiting factor L-dopachrome tautomerase L-dopachrome isomerase protein protein human Homo sapiens Human MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA DIP protein P14174 original sequence version: 138 DIP protein P14174 original sequence version: 186 56D51107C05286B2 mif-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mif-2 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction