DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221060X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221057X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221059X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221061X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221062X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221056X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. The action of cardiolipin on the bacterial translocon. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gold VA., Robson A., Bao H., Romantsov T., Duong F., Collinson I. DIP original experiment: DIP-221058X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The action of cardiolipin on the bacterial translocon. secg_ecoli Protein-export membrane protein SecG P12 Preprotein translocase band 1 subunit JW3142 b3175 secG protein protein ecoli Escherichia coli (strain K12) MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN DIP protein P0AG99 original sequence version: 77 DIP protein P0AG99 original sequence version: 39 DIP protein P0AG99 original sequence version: 54 DIP protein P0AG99 original sequence version: 46 8DC7663F94D32F2F seca_ecoli Protein translocase subunit SecA secA azi pea prlD b0098 JW0096 protein protein ecoli Escherichia coli (strain K12) MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRLQ DIP protein P10408 original sequence version: 150 DIP protein P10408 original sequence version: 130 DIP protein P10408 original sequence version: 105 DIP protein P10408 original sequence version: 107 DIP protein P10408 original sequence version: 125 DIP protein P10408 original sequence version: 140 DIP protein P10408 original sequence version: null 683D66DD4305DBC2 sece_ecoli Protein translocase subunit SecE JW3944 b3981 secE prlG protein protein ecoli Escherichia coli (strain K12) MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGLRF DIP protein P0AG96 original sequence version: 42 DIP protein P0AG96 original sequence version: 58 DIP protein P0AG96 original sequence version: 50 94D37280522875CE secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR DIP protein P0AGA2 original sequence version: 78 DIP protein P0AGA2 original sequence version: 60 DIP protein P0AGA2 original sequence version: 41 DIP protein P0AGA2 original sequence version: 56 DIP protein P0AGA2 original sequence version: 49 711CA63CD8809763 sece-secg-1 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association sece-secg-2 7 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association secg-secy-2 1 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction secy-1 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction sece-1 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction seca-sece-1 2 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association sece-secy-3 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction