DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217086X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217087X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217090X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217088X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217089X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. Nature structural & molecular biology 2010 imex curation Pieren M., Schmidt A., Mayer A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pieren M., Schmidt A., Mayer A. DIP original experiment: DIP-217091X Nature structural & molecular biology 2010 IMEx The SM protein Vps33 and the t-SNARE H(abc) domain promote fusion pore opening. vam6_yeast Vacuolar morphogenesis protein 6 Vacuolar protein sorting-associated protein 39 CVT4 VAM6 VPL18 VPL22 VPS39 YDL077C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRAQKLHSLKSSDITAILPTEQSQKLVLAKKNGDVEVYSRDGNTLKLFQVYPDLLQNAKNDPLPPVIENFYFANELSTIFAQCKETLILLSTTNLHEYDRIIDRRGINHCWLFERSHKNKEEKNTYLIYSTINTAKMRVLIWEGRTYKNMMEASLSYRKETIRSIYPGETGITLATDLGIYHWPYNKPSLIRIEKTVKNKFPKDMISALTELKEQAEKVIEKKPKKNSHFDAQSFSSMDRMSRKSSMSSLWYRTIRNERGNKIRYTFELDGNDATPMIIDGATKKIFKVELMHNNEEPFLIATDHATFSESNSEFDHMQYLSSNLLMLYNSSTIKFVDYENGFTFLQQKIPEGIKWVKNLSGTYFLVWTSNDEVQLFSYHVDDGSEDDDQESICGDINDPDFYQLWRKVLFYKFFIDSPHSKELCVSDNPEESLDICAMKLRDLTVMWCLRIFDKFQNYMVQLERSRNSRMIRSKCEEMIIKSIFDLFIKFWAPPQLVILKVFPSAISSLVLEITGQEHHCLLKEAEEVKETYDIPPHLLNRWCLPYLTDTRRHLQNLLSKENDDESRITWCYRDREIKQSFDFFLISNHDDVDLNTMLTLIDTVLFKCYLYYNPPMVGPFIRVENHCDSHVIVTELKIRHMFKDLIDFYYKRGNHEEALKFLTDLVDELENDNTDQKQRQKIDHGVKILVIYYLKKLSNPQLDVIFTYTDWLLNRHNDSIKEILSSIFFYDSQACSSRDHLKVYGYIKKFDKLLAIQYLEFAISTFRLEGNKLHTVLIKLYLENLDIPSTRIKLKSLLETTSVYEPRTILKLLNDAIESGSDQLPTNQLNFVKYLKIFPLSKLENHKEAVHILLDEIDDYKAATSYCNDVYQSDSTKGEELLLYLYSKLVSIYDSNRNSKLILNFLQDHGSKLNSAEIYKNLPQDISLYDIGRVVSQLLKKHTSKMDETRLEKALLQVELVATTYKLNERMSSYGVLSDSHKCPICKKVISNFGTDSISWFTREGRNIITHYNCGKVLQERFNAKNEKSSRIKQKTLGEVINELNNK EE8D94E7E2F5F078 EE8D94E7E2F5F078 nyv1_yeast Vacuolar v-SNARE NYV1 NYV1 Synaptobrevin NYV1 New v-SNARE 1 MAM2 YLR093C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW 494B587CF0F85997 494B587CF0F85997 vam3_yeast Syntaxin VAM3 VAM3 PTH1 YOR106W YOR3220W Vacuolar morphogenesis protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS 6415D9D852C6C64D 6415D9D852C6C64D vps33_yeast Vacuolar protein sorting-associated protein 33 VPS33 SLP1 Protein SLP1 Vacuolar morphogenesis protein 5 VAM5 L8084.15 YLR396C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRFWNTKKFSLTNADGLCATLNEISQNDEVLVVQPSVLPVLNSLLTFQDLTQSTPVRKITLLDDQLSDDLPSALGSVPQMDLIFLIDVRTSLRLPPQLLDAAQKHNLSSLHIIYCRWKPSFQNTLEDTEQWQKDGFDLNSKKTHFPNVIESQLKELSNEYTLYPWDLLPFPQIDENVLLTHSLYNMENVNMYYPNLRSLQSATESILVDDMVNSLQSLIFETNSIITNVVSIGNLSKRCSHLLKKRIDEHQTENDLFIKGTLYGERTNCGLEMDLIILERNTDPITPLLTQLTYAGILDDLYEFNSGIKIKEKDMNFNYKEDKIWNDLKFLNFGSIGPQLNKLAKELQTQYDTRHKAESVHEIKEFVDSLGSLQQRQAFLKNHTTLSSDVLKVVETEEYGSFNKILELELEILMGNTLNNDIEDIILELQYQYEVDQKKILRLICLLSLCKNSLREKDYEYLRTFMIDSWGIEKCFQLESLAELGFFTSKTGKTDLHITTSKSTRLQKEYRYISQWFNTVPIEDEHAADKITNENDDFSEATFAYSGVVPLTMRLVQMLYDRSILFHNYSSQQPFILSREPRVSQTEDLIEQLYGDSHAIEESIWVPGTITKKINASIKSNNRRSIDGSNGTFHAAEDIALVVFLGGVTMGEIAIMKHLQKILGKKGINKRFIIIADGLINGTRIMNSIS ED78DF55109C20E7 ED78DF55109C20E7 pep3_yeast Vacuolar membrane protein PEP3 VAM8 VPS18 VPT18 L9634.2 YLR148W PEP3 Vacuolar protein sorting-associated protein 18 Vacuolar morphogenesis protein 8 Vacuolar protein-targeting protein 18 Carboxypeptidase Y-deficient protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKTRIEEVQLQFLTGNTELTHLKVSNDQLIVTTQRTIYRINLQDPAIVNHFDCPLSKELETIMNVHVSPMGSVILIRTNFGRYMLLKDGEFTQLNKIKNLDLSSLHWINETTFLMGIKKTPKLYRVELTGKDITTKLWYENKKLSGGIDGIAYWEGSLLLTIKDNILYWRDVTNMKFPLVLPDESEQFERLKHHAIKKFDSYNGLFAWVTSNGIVFGDLKEKQMEKDPASNNFGKFLSSSKVLLNFELPDYQNDKDHLIKDIVLTAFHILLLRKNTVTMVSQLNNDVVFHETIPRHQLTGSNTDSNEKFLGLVRDSVKETFWCFSNINVFEIIIENEPNSVWNLLVRDNKFDKALSLKGLTVREIESVKLSKAMYLFHTAKDFHSAAQTLGSMKDLSHFGEIALNFLQIKDYNDLNVILIKQLDNVPWKSTQVVLSSWIIWNFMKQLNDIELKINTTKPASTDEDNLLNWNLNLKEKSNELTKFLESHLEKLDNETVYQIMSKQNRQNELLIFASLINDMKFLLSFWIDQGNWYESLKILLTINNHDLVYKYSLILLLNSPEATVSTWMKIKDLDPNKLIPTILKFFTNWQNNSKLITNISEYPENYSLTYLKWCVREVPKMCNPIVYNSILYMMITDPRNDMILENDIIKFMKSNENKYDLNFQLRLSLKFKKTKTSIFLLTRLNLFEDAIDLALKNNLIDDCKVIVNDEILIEDYKLRKRLWLKIAKHLLLSMKDIDIKQLIRTILNDSNEILTIKDLLPFFNEYTTIANLKEELIKFLENHNMKMNEISEDIINSKNLKVEINTEISKFNEIYRILEPGKSCDECGKFLQIKKFIVFPCGHCFHWNCIIRVILNSNDYNLRQKTENFLKAKSKHNLNDLENIIVEKCGLCSDININKIDQPISIDETELAKWNE 37AE3C34AE0470B8 37AE3C34AE0470B8 nyv1-vam3-1 1 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps33-vam3-1 4 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P20795:p.Asp88Lys D88K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D K This feature has been corrected as a result of our quality control procedures. The original label was 'D88K'. Wed May 02 14:39:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp88lys' Tue Jun 30 19:35:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp88Lys' P20795:p.Leu184Pro L184P mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L184P'. Wed May 02 19:55:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu184pro' Tue Jun 30 16:37:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu184Pro' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps33-vam3-2 3 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P20795:p.Asp88Lys D88K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D K This feature has been corrected as a result of our quality control procedures. The original label was 'D88K'. Wed May 02 20:00:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp88lys' Tue Jun 30 17:17:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp88Lys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey N-terminal domain Region 1-144 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps33-vam3-3 2 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association vam3-nyv1-4 5 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association vps33-vam3-4 6 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association