DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. DIP original experiment: DIP-219755X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. DIP original experiment: DIP-219756X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. DIP original experiment: DIP-219758X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Malashkevich VN., Dulyaninova NG., Ramagopal UA., Liriano MA., Varney KM., Knight D., Brenowitz M., Weber DJ., Almo SC., Bresnick AR. DIP original experiment: DIP-219757X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phenothiazines inhibit S100A4 function by inducing protein oligomerization. myh9_human Myosin-9 MYH9 Myosin heavy chain 9 Myosin heavy chain, non-muscle IIa Non-muscle myosin heavy chain IIa Cellular myosin heavy chain, type A Non-muscle myosin heavy chain A protein protein human Homo sapiens Human MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE DIP protein P35579 original sequence version: 126 DIP protein P35579-1 original sequence version: 142 DIP protein P35579-1 original sequence version: 133 DIP protein P35579 original sequence version: 186 DIP protein P35579-1 original sequence version: 186 DIP protein P35579-1 original sequence version: 146 DIP protein P35579 original sequence version: 146 588F84BB8C106E6F s10a4_human Protein S100-A4 S100 calcium-binding protein A4 Metastasin Protein Mts1 Placental calcium-binding protein Calvasculin S100A4 CAPL MTS1 protein protein human Homo sapiens Human MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK DIP protein P26447 original sequence version: 119 DIP protein P26447 original sequence version: 123 286D2B7B07EDB562 s100a4-1 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction s100a4-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction s100a4-3 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction myh9-s100a4-1 3 5 unspecified role unspecified role unspecified role unspecified role Region 1339-1960 Region 1339-1960 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction