DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221015X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221021X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221014X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221018X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221022X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221012X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221016X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221023X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221011X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221020X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221013X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221019X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221017X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP DIP protein P70288 original sequence version: 83 DIP protein P70288 original sequence version: 123 DIP protein P70288 original sequence version: 112 DIP protein P70288 original sequence version: 99 DIP protein P70288 original sequence version: 155 DIP protein P70288 original sequence version: 117 B9843D24A775157C hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 kdm1a_mouse Lysine-specific histone demethylase 1A Kdm1a Kiaa0601 Lsd1 Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 Aof2 protein protein mouse Mus musculus Mouse MLSGKKAAAAAAAAAAAAAAGTEAGSGAAGGAENGSEVAAPPAGLTGPTDMATGAAGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM DIP protein Q6ZQ88 original sequence version: 98 DIP protein Q6ZQ88 original sequence version: 82 DIP protein Q6ZQ88 original sequence version: 125 DIP protein Q6ZQ88 original sequence version: 86 DIP protein Q6ZQ88 original sequence version: 65 43CD401FA0452B2F mta2_mouse Metastasis-associated protein MTA2 Mta2 Mta1l1 Metastasis-associated 1-like 1 protein protein mouse Mus musculus Mouse MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLTQNRGLGGIMVKRSYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLMTVRPPVPLPASSHPASTNEPIVLED DIP protein Q9R190 original sequence version: 108 DIP protein Q9R190 original sequence version: 99 DIP protein Q9R190 original sequence version: 119 DIP protein Q9R190 original sequence version: 138 DIP protein Q9R190 original sequence version: 144 DIP protein Q9R190 original sequence version: 111 88996F779BA6F4D1 sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 sin3a-hdac1-5 9 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association hdac2-hdac1-3 1 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mta2-hdac1-8 10 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association hdac2-mta2-1 12 14 unspecified role unspecified role bait bait mouse Mus musculus Mouse 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association mta2-hdac1-9 6 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association kdm1a-hdac1-1 2 16 unspecified role unspecified role bait bait mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association sin3a-hdac2-2 7 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association kdm1a-hdac1-2 11 16 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association hdac1-hdac2-10 3 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association mta2-hdac2-1 13 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association sin3a-hdac1-6 5 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association kdm1a-hdac2-1 4 16 unspecified role unspecified role bait bait mouse Mus musculus Mouse 14 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association hdac1-kdm1a-1 8 17 unspecified role unspecified role prey prey mouse Mus musculus Mouse 16 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association