DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219735X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219739X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219734X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219736X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219737X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219738X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219733X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rao Y., Ma Q., Vahedi-Faridi A., Sundborger A., Pechstein A., Puchkov D., Luo L., Shupliakov O., Saenger W., Haucke V. DIP original experiment: DIP-219740X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation. p49418-1 Amphiphysin AMPH AMPH1 128 kDa protein protein human Homo sapiens Human MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKGPPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFKPEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSMICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTLVSAAEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD DIP protein P49418-1 original sequence version: 113 sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH DIP protein Q99962 original sequence version: 111 DIP protein Q99962 original sequence version: 141 F3AE2353E1EB7CF3 dyn1_human Dynamin-1 DNM1 DNM protein protein human Homo sapiens Human MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQASPSRPESPRPPFDL DIP protein Q05193 original sequence version: 142 DIP protein Q05193 original sequence version: 113 DIP protein Q05193 original sequence version: 100 DIP protein Q05193 original sequence version: 115 DIP protein Q05193-1 original sequence version: 111 DIP protein Q05193 original sequence version: 153 7FCD8CB572FFEAEF pacn1_mouse Protein kinase C and casein kinase substrate in neurons protein 1 Pacsin Pacsin1 Syndapin-1 protein protein mouse Mus musculus Mouse MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI DIP protein Q61644 original sequence version: 89 21BEB339A14A41F9 pacsin1-pacsin1-1 1 12 unspecified role unspecified role bait bait SH3 domain Region 379-441 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q61644:p.[Asp394Arg;Glu400Arg] E400R/Q394R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain D R Wed May 02 16:54:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp394arg,glu400arg' Tue Jun 30 18:01:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp394Arg;Glu400Arg]' Q61644:p.[Gln396Arg;Glu397Arg] Q396R/E397R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain Q R This feature has been corrected as a result of our quality control procedures. The original label was 'Q396R/E397R'. Wed May 02 16:11:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln396arg,glu397arg' Tue Jun 30 19:02:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln396Arg;Glu397Arg]' ecolx Escherichia coli 12 unspecified role unspecified role prey prey F-Bar domain Region 1-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pacsin1-1 7 12 unspecified role unspecified role unspecified role unspecified role F-Bar domain Region 1-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction amph-pacsin1-1 2 12 unspecified role unspecified role prey prey F-Bar domain Region 1-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role bait bait SH3 domain Region 546-695 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction amph-amph-1 5 9 unspecified role unspecified role prey prey Bar domain Region 1-245 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role bait bait SH3 domain Region 546-695 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction pacsin1-pacsin1-2 3 12 unspecified role unspecified role bait bait SH3 domain Region 379-441 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey F-Bar domain Region 1-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q61644:p.[Lys145Glu;Lys146Glu;Lys148Glu] K145E/K146E/K148E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K145E/K146E/K148E'. Wed May 02 15:36:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys145glu,lys146glu,lys148glu' Tue Jun 30 20:09:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys145Glu;Lys146Glu;Lys148Glu]' ecolx Escherichia coli direct interaction direct interaction sh3gl2-sh3gl2-1 4 10 unspecified role unspecified role prey prey Bar domain Region 1-256 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait SH3 domain Region 245-352 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction pacsin1-dnm1-2 8 11 unspecified role unspecified role prey prey Proline-rich domain Region 509-864 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role bait bait SH3 domain Region 379-441 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q61644:p.Glu400Arg E400R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E400R'. Wed May 02 15:17:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu400arg' Tue Jun 30 17:22:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu400Arg' Q61644:p.Pro434Leu P434L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L This feature has been corrected as a result of our quality control procedures. The original label was 'P434L'. Wed May 02 17:25:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro434leu' Tue Jun 30 15:48:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro434Leu' Q61644:p.[Asp394Arg;Glu400Arg] E400R/Q394R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain D R Wed May 02 15:33:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp394arg,glu400arg' Tue Jun 30 19:49:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp394Arg;Glu400Arg]' ecolx Escherichia coli direct interaction direct interaction sh3gl2-pacsin1-1 6 12 unspecified role unspecified role prey prey F-Bar domain Region 1-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role bait bait SH3 domain Region 245-352 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction