DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216862X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions human Homo sapiens Human electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216857X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216858X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216863X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216860X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216861X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. Structure (London, England : 1993) 2010 imex curation Enchev RI., Schreiber A., Beuron F., Morris EP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Enchev RI., Schreiber A., Beuron F., Morris EP. DIP original experiment: DIP-216859X Structure (London, England : 1993) 2010 IMEx Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3. csn8_human COP9 signalosome complex subunit 8 COPS8 CSN8 JAB1-containing signalosome subunit 8 COP9 homolog protein protein human Homo sapiens Human MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN DIP protein Q99627 original sequence version: 79 DIP protein Q99627-1 original sequence version: 118 DIP protein Q99627 original sequence version: 135 203E236D8E304A8A csn6_human COP9 signalosome complex subunit 6 COPS6 CSN6 HVIP JAB1-containing signalosome subunit 6 Vpr-interacting protein MOV34 homolog protein protein human Homo sapiens Human MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF DIP protein Q7L5N1 original sequence version: 63 DIP protein Q7L5N1 original sequence version: 102 DIP protein Q7L5N1 original sequence version: 119 E33CAC6ADF799A8D csn7b_human COP9 signalosome complex subunit 7b COPS7B CSN7B JAB1-containing signalosome subunit 7b protein protein human Homo sapiens Human MAGEQKPSSNLLEQFILLAKGTSGSALTALISQVLEAPGVYVFGELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH DIP protein Q9H9Q2 original sequence version: 54 FF9279CEA6CB7707 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA csn2_human COP9 signalosome complex subunit 2 JAB1-containing signalosome subunit 2 Thyroid receptor-interacting protein 15 Alien homolog COPS2 CSN2 TRIP15 protein protein human Homo sapiens Human MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA DIP protein P61201 original sequence version: 67 DIP protein P61201-1 original sequence version: 106 DIP protein P61201 original sequence version: 122 DIP protein P61201-1 original sequence version: 76 1DB6FA774C13BC59 csn4_human COP9 signalosome complex subunit 4 COPS4 CSN4 JAB1-containing signalosome subunit 4 protein protein human Homo sapiens Human MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ DIP protein Q9BT78 original sequence version: 72 DIP protein Q9BT78-1 original sequence version: 115 DIP protein Q9BT78 original sequence version: 132 DIP protein Q9BT78 original sequence version: 110 4EFF9079058EB609 csn3_human COP9 signalosome complex subunit 3 COPS3 CSN3 JAB1-containing signalosome subunit 3 protein protein human Homo sapiens Human MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS DIP protein Q9UNS2 original sequence version: 82 DIP protein Q9UNS2-1 original sequence version: 122 DIP protein Q9UNS2 original sequence version: 140 1D371050C7D7BF8D rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E csn7a_human COP9 signalosome complex subunit 7a JAB1-containing signalosome subunit 7a Dermal papilla-derived protein 10 COPS7A CSN7A DERP10 protein protein human Homo sapiens Human MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN DIP protein Q9UBW8 original sequence version: 69 DIP protein Q9UBW8 original sequence version: 106 DIP protein Q9UBW8 original sequence version: 123 20888B35BFFF6326 csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF csn1_human COP9 signalosome complex subunit 1 JAB1-containing signalosome subunit 1 G protein pathway suppressor 1 Protein MFH GPS1 COPS1 CSN1 protein protein human Homo sapiens Human MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM DIP protein Q13098 original sequence version: 97 DIP protein Q13098 original sequence version: 154 DIP protein Q13098 original sequence version: 134 BF925164ED985638 cops2-cops3-1 2 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 16 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 17 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 14 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 12 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 18 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association cops2-cops3-2 3 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 13 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cul1-rbx1-15 6 15 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cops5-cops2-1 4 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 13 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association cops2-cops3-3 7 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 13 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cul1-rbx1-16 1 15 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cops3-cops2-10 5 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 17 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 13 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 18 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association