HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. Cellular microbiology 2010 imex curation Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. bfinlay@ interchange.ubc.ca 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. interactions with EMP24/GPL25 and TIM17 are not added since version are not specified bfinlay@ interchange.ubc.ca Accepted 2017-MAY-03 AT 10:11 BST AT 10:11 BST by ORCHARD Hela cell cDNA Cellular microbiology 2010 imex curation The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. Cellular microbiology 2010 imex curation Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. bfinlay@ interchange.ubc.ca 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. interactions with EMP24/GPL25 and TIM17 are not added since version are not specified bfinlay@ interchange.ubc.ca Accepted 2017-MAY-03 AT 10:11 BST AT 10:11 BST by ORCHARD Hela Cellular microbiology 2010 imex curation The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. Cellular microbiology 2010 imex curation Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. bfinlay@ interchange.ubc.ca 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. interactions with EMP24/GPL25 and TIM17 are not added since version are not specified bfinlay@ interchange.ubc.ca Accepted 2017-MAY-03 AT 10:11 BST AT 10:11 BST by ORCHARD Hela Cellular microbiology 2010 imex curation The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. The pathogenic E. coli type III effector EspZ interacts with host CD98 and facilitates host cell prosurvival signalling. Cellular microbiology 2010 imex curation Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. bfinlay@ interchange.ubc.ca 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Shames SR., Deng W., Guttman JA., de Hoog CL., Li Y., Hardwidge PR., Sham HP., Vallance BA., Foster LJ., Finlay BB. mass spectrometry-based stable isotope labelling of amino acids in cell culture (SILAC) is used bfinlay@ interchange.ubc.ca Accepted 2017-MAY-03 AT 10:11 BST AT 10:11 BST by ORCHARD Cellular microbiology 2010 imex curation mlf1_human Myeloid leukemia factor 1 Myelodysplasia-myeloid leukemia factor 1 MLF1 protein protein human Homo sapiens Human MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK 08774217329F737A pmel_human Melanocyte protein PMEL PMEL D12S53E PMEL17 SILV ME20-M Melanocyte protein Pmel 17 Melanocytes lineage-specific antigen GP100 Melanoma-associated ME20 antigen P1 P100 Premelanosome protein Silver locus protein homolog protein protein human Homo sapiens Human MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPLTSCGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTSVQVPTTEVISTAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIVGILLVLMAVVLASLIYRRRLMKQDFSVPQLPHSSSHWLRLPRIFCSCPIGENSPLLSGQQV DIP protein P40967 original sequence version: 100 8A904FAB16715653 cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 85AC8E235C6E425F pcbp1_human Poly(rC)-binding protein 1 PCBP1 Alpha-CP1 Nucleic acid-binding protein SUB2.3 Heterogeneous nuclear ribonucleoprotein E1 protein protein human Homo sapiens Human MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS DIP protein Q15365 original sequence version: 141 DIP protein Q15365 original sequence version: 116 6D1A261276CA206D fxyd5_human FXYD domain-containing ion transport regulator 5 FXYD5 DYSAD IWU1 HSPC113 UNQ2561/PRO6241 Dysadherin protein protein human Homo sapiens Human MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR 7429C04838B75AA1 rs27a_human Ubiquitin-40S ribosomal protein S27a RPS27A UBA80 UBCEP1 Ubiquitin carboxyl extension protein 80 protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 617BC63DF3A904F7 cd83_human CD83 antigen CD83 B-cell activation protein Cell surface protein HB15 protein protein human Homo sapiens Human MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV 1D77133595F2B852 cea19_human Carcinoembryonic antigen-related cell adhesion molecule 19 CEACAM19 CEAL1 Carcinoembryonic antigen-like 1 UNQ2973/PRO7436 protein protein human Homo sapiens Human MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYLLVTRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPAPYCQLVPTS 677A8CD284514DC5 hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD hs90b_human Heat shock protein HSP 90-beta HSP90AB1 HSP90B HSPC2 HSPCB Heat shock 84 kDa protein protein human Homo sapiens Human MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRMEEVD DIP protein P08238 original sequence version: 91 DIP protein P08238 original sequence version: 149 DIP protein P08238 original sequence version: 165 DIP protein P08238 original sequence version: 167 DIP protein P08238 original sequence version: 210 DIP protein P08238 original sequence version: 187 A93118C214D03810 o52302_ecolx sepZ espZ BJJ90_23640 B6R12_005237 B6R15_003114 NCTC8622_07612 E2135_19530 protein protein ecolx Escherichia coli MDAANLSPSGGVLPLAATINGNVSVDENTGVMTPENGGSRNIRIVAGIALATTALAALGTGIAMACTTNASSQEFLGLGIATGVLGGVTALGGGLAMKYA ED0CDF48C78D8557 cd99_human CD99 antigen T-cell surface glycoprotein E2 E2 antigen Protein MIC2 12E7 CD99 MIC2 MIC2X MIC2Y protein protein human Homo sapiens Human MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK C302E09E6B022EAB 4f2_human 4F2 cell-surface antigen heavy chain Lymphocyte activation antigen 4F2 large subunit 4F2 heavy chain antigen SLC3A2 MDU1 Solute carrier family 3 member 2 protein protein human Homo sapiens Human MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA AE427F8204CC10B0 espz-multi-1 4 13 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 14 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 15 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association table 1 espz-cd98-1 1 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association table 2 sepz-cd63-1 1 15 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association table 2 sepz-pmel-1 1 15 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association table 2 sepz-fxyd5-1 1 15 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association table 2 sepz-mlf1-1 1 15 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association table 2 sepz-cd83-1 1 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association table 2 sepz-cd99-1 1 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association table 2 sepz-pcbp1-1 1 15 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association table 2 sepz-ceacam19-1 1 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association table 2 sepz-slc3a2-1 3 15 unspecified role unspecified role neutral component neutral component n terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4A-B sepz-slc3a2-2 2 15 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4D slc3a2-sepz-1 2 15 unspecified role unspecified role prey prey n terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4F