DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254188X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254187X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254189X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254185X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Coordination of Rab8 and Rab11 in primary ciliogenesis. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254186X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. rab3i_human Rab-3A-interacting protein Rabin-3 SSX2-interacting protein RAB3IP RABIN8 protein protein human Homo sapiens Human MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL DIP protein Q96QF0 original sequence version: 71 DIP protein Q96QF0 original sequence version: 112 DD77781823038F15 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 q96qf0-2 Rab-3A-interacting protein alpha1 RAB3IP Rabin-3 SSX2-interacting protein RABIN8 protein protein human Homo sapiens Human MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL DIP protein Q96QF0-2 original sequence version: 71 DIP protein Q96QF0-2 original sequence version: 116 ED659E364B5C75FA rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D rab3ip-rab11a-3 4 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P62491:p.Gln70Leu Q70L mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 15:16:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 20:00:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' P62491:p.Ser25Asn S25N mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S N This feature has been corrected as a result of our quality control procedures. The original label was 'S25N'. Wed May 02 16:23:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser25asn' Tue Jun 30 18:23:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser25Asn' ecolx Escherichia coli direct interaction direct interaction rab3ip-bbs1-3 3 6 unspecified role unspecified role bait bait human Homo sapiens Human 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rab3ip-rab8a-3 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rab3ip-rab11a-4 5 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-331 Region 1-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab3ip-bbs1-4 1 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-331 Region 1-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association