DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216812X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216816X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216809X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216805X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216811X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216813X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216817X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216804X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216818X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216815X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216808X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216802X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216814X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216819X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216803X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216810X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216806X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. Structure (London, England : 1993) 2010 imex curation Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Park AY., Jergic S., Politis A., Ruotolo BT., Hirshberg D., Jessop LL., Beck JL., Barsky D., O'Donnell M., Dixon NE., Robinson CV. DIP original experiment: DIP-216807X Structure (London, England : 1993) 2010 IMEx A single subunit directs the assembly of the Escherichia coli DNA sliding clamp loader. hold_ecoli DNA polymerase III subunit psi holD b4372 JW4334 protein protein ecoli Escherichia coli (strain K12) MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICTYEHDFFPRND DIP protein P28632 original sequence version: 88 DIP protein P28632 original sequence version: null 5B7356201E7E27FE dpo3x_ecoli DNA polymerase III subunit tau dnaX dnaZ dnaZX b0470 JW0459 DNA polymerase III subunit gamma protein protein ecoli Escherichia coli (strain K12) MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQAPTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI DIP protein P06710 original sequence version: 106 DIP protein P06710 original sequence version: null D2028BD99E375150 holc_ecoli DNA polymerase III subunit chi holC b4259 JW4216 protein protein ecoli Escherichia coli (strain K12) MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK 7FEFFC359B28AA88 7FEFFC359B28AA88 hola_ecoli DNA polymerase III subunit delta b0640 holA JW0635 protein protein ecoli Escherichia coli (strain K12) MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELDDAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG 87239A678FE16BE2 87239A678FE16BE2 holb_ecoli DNA polymerase III subunit delta' holB b1099 JW1085 protein protein ecoli Escherichia coli (strain K12) MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREVTMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQAPARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQLMSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL DIP protein P28631 original sequence version: 95 DIP protein P28631 original sequence version: null DC9DAA644AD8A096 tau/gamma-1 12 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction delta-delta'-1 6 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chi-delta-1 2 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association tau/gamma-2 15 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chi-psi-1 3 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association chi-delta-2 7 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association chi-delta'-1 13 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association delta-1 8 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction delta-delta'-2 14 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association chi-psi-2 16 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association delta'-1 4 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction chi-psi-3 17 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction delta-delta'-3 5 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association delta-tau/gamma-1 18 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction delta-delta'-4 1 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association tau/gamma-tau/gamma-1 9 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role gamma subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chi-delta'-2 10 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association delta'-tau/gamma-1 11 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 23 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction