DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133679X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133684X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133682X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133678X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133677X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133681X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133680X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133683X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133686X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Orm family proteins mediate sphingolipid homeostasis. Nature 2010 imex curation Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Breslow DK., Collins SR., Bodenmiller B., Aebersold R., Simons K., Shevchenko A., Ejsing CS., Weissman JS. DIP original experiment: DIP-133685X Nature 2010 IMEx Orm family proteins mediate sphingolipid homeostasis. sptc1_human Serine palmitoyltransferase 1 Serine-palmitoyl-CoA transferase 1 Long chain base biosynthesis protein 1 SPTLC1 LCB1 protein protein human Homo sapiens Human MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL DIP protein O15269 original sequence version: 130 DIP protein O15269 original sequence version: 92 DIP protein O15269 original sequence version: 146 BA9E056A869D2EA2 lcb2_yeast Serine palmitoyltransferase 2 LCB2 SCS1 YDR062W YD9609.16 D4246 TSC1 Long chain base biosynthesis protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTPANYTRVPLCEPEELPDDIQKENEYGTLDSPGHLYQVKSRHGKPLPEPVVDTPPYYISLLTYLNYLILIILGHVHDFLGMTFQKNKHLDLLEHDGLAPWFSNFESFYVRRIKMRIDDCFSRPTTGVPGRFIRCIDRISHNINEYFTYSGAVYPCMNLSSYNYLGFAQSKGQCTDAALESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKKCLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIREQIVLGQPKTNRPWKKILICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCEIFGVDPKDVDILMGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMPAPVLAQTISSLQTISGEICPGQGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPLLLYCPSKMPAFSRMMLQRRIAVVVVAYPATPLIESRVRFCMSASLTKEDIDYLLRHVSEVGDKLNLKSNSGKSSYDGKRQRWDIEEVIRRTPEDCKDDKYFVN 06DF4A709CC9F29B 06DF4A709CC9F29B tsc3_yeast Serine palmitoyltransferase-regulating protein TSC3 TSC3 Temperature-sensitive CSG2-mutant suppressor protein 3 YBR058C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFFLTIFSLSFFGILKYCFL F23EE19603FEC87E F23EE19603FEC87E lcb1_yeast Serine palmitoyltransferase 1 YMR296C LCB1 END8 TSC2 Long chain base biosynthesis protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVEIGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAKTPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGACGPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSLPVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDLAPLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGSTGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSLHDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNKFIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKNACESVKQSILACCQESNK 9F7F93E4B2C70FDB 9F7F93E4B2C70FDB sac1_yeast Phosphatidylinositol-3-phosphatase SAC1 SAC1 RSD1 YKL212W Recessive suppressor of secretory defect Phosphatidylinositol-4-phosphate phosphatase protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGPIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQGEVVKIASLMGFIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKFNSRIDSEEAEYIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVFSFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNYLVNLVNQKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEKLGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRLGAFNDFLNSASRYYQNNWTDGPRQDSYDLFLGGFRPHTASIKSPFPDRRPVYIQLIPMIICAALTVLGATIFFPKDRFTSSKNLLYFAGASIVLALSTKFMFKNGIQFVNWPKLVDVGFLVVHQTHDKEQQFKGLKYAQSPKFSKPDPLKRD 73DB1FA163BC17AE 73DB1FA163BC17AE orm1_yeast Protein ORM1 YGR038W ORM1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTELDYQGTAEAASTSYSRNQTDLKPFPSAGSASSSIKTTEPVKDHRRRRSSSIISHVEPETFEDENDQQLLPNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYVIGSYVMFHLIKGTPFDFNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAHYDLKLFSWNCFLTTFGAVVPKLPVTHRLRISIPGITGRAQIS 4387D00ACE4F3A1D 4387D00ACE4F3A1D orm2_yeast Protein ORM2 ORM2 YLR350W protein protein yeast Saccharomyces cerevisiae Baker's yeast MIDRTKNESPAFEESPLTPNVSNLKPFPSQSNKISTPVTDHRRRRSSSVISHVEQETFEDENDQQMLPNMNATWVDQRGAWLIHIVVIVLLRLFYSLFGSTPKWTWTLTNMTYIIGFYIMFHLVKGTPFDFNGGAYDNLTMWEQINDETLYTPTRKFLLIVPIVLFLISNQYYRNDMTLFLSNLAVTVLIGVVPKLGITHRLRISIPGITGRAQIS 2F474503CAB7C195 2F474503CAB7C195 orml3_human ORM1-like protein 3 ORMDL3 protein protein human Homo sapiens Human MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY DIP protein Q8N138 original sequence version: 56 3EF483CA5C03EC2E orm1-lcb1-1 5 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association orm2-lcb1-1 4 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association orm2-lcb1-2 8 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association orm2-lcb1-3 9 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association orm1-lcb1-2 2 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ormdl3-sptlc1-1 6 11 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ormdl3-sptlc1-2 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 18 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association lcb1-lcb2-8 1 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association orm1-lcb1-3 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association orm2-lcb1-4 10 17 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association