DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216966X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216958X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216964X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216962X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216957X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216961X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216960X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216959X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216963X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216967X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Mediator head module structure and functional interactions. Nature structural & molecular biology 2010 imex curation Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Cai G., Imasaki T., Yamada K., Cardelli F., Takagi Y., Asturias FJ. DIP original experiment: DIP-216965X Nature structural & molecular biology 2010 IMEx Mediator head module structure and functional interactions. rpb4_yeast DNA-directed RNA polymerase II subunit RPB4 RPB4 YJL140W J0654 DNA-directed RNA polymerase II 32 kDa polypeptide B32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY 72A8A26871B87775 72A8A26871B87775 med18_yeast Mediator of RNA polymerase II transcription subunit 18 YGR104C SRB5 MED18 Mediator complex subunit 18 Suppressor of RNA polymerase B 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI B1148FC187C2802A B1148FC187C2802A med11_yeast Mediator of RNA polymerase II transcription subunit 11 YMR112C YM9718.11C Mediator complex subunit 11 MED11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 457D13C6030F33CC 457D13C6030F33CC med17_yeast Mediator of RNA polymerase II transcription subunit 17 YER022W SRB4 MED17 Mediator complex subunit 17 Suppressor of RNA polymerase B 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV D25B2993A1BADFD6 D25B2993A1BADFD6 med6_yeast Mediator of RNA polymerase II transcription subunit 6 MTR32 YHR058C Mediator complex subunit 6 MED6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI B84E87DCC2737849 B84E87DCC2737849 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE med22_yeast Mediator of RNA polymerase II transcription subunit 22 SRB6 YBR253W YBR1721 MED22 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT 7703E4FAE101A31F 7703E4FAE101A31F med20_yeast Mediator of RNA polymerase II transcription subunit 20 YHR041C SRB2 HRS2 MED20 Mediator complex subunit 20 Suppressor of RNA polymerase B 2 Hyper-recombination suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL C30BF309D43AFB2A C30BF309D43AFB2A med8_yeast Mediator of RNA polymerase II transcription subunit 8 YBR193C YBR1403 MED8 Mediator complex subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN 86B2A064293C6B61 86B2A064293C6B61 rpb7_yeast DNA-directed RNA polymerase II subunit RPB7 RPB7 YDR404C D9509.22 B16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 44C85603A93CDE67 44C85603A93CDE67 med11-med17-1 4 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med17-med11-1 5 16 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association med17-med11-2 2 16 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association med11-med17-2 11 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med17-rpb7-1 1 21 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med11-med17-3 3 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med17-tbp-1 9 17 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med11-med17-4 7 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med11-med17-5 6 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med11-med17-6 10 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association med17-med11-3 8 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association