DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215971X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215968X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215967X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215966X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215969X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215972X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215973X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Structural determinants of growth factor binding and specificity by VEGF receptor 2. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Leppänen VM., Prota AE., Jeltsch M., Anisimov A., Kalkkinen N., Strandin T., Lankinen H., Goldman A., Ballmer-Hofer K., Alitalo K. DIP original experiment: DIP-215970X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural determinants of growth factor binding and specificity by VEGF receptor 2. vegfc_human Vascular endothelial growth factor C VEGFC Flt4 ligand Vascular endothelial growth factor-related protein protein protein human Homo sapiens Human MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS DIP protein P49767 original sequence version: 98 9F598719DB3E014F vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV DIP protein P35968 original sequence version: 81 DIP protein P35968 original sequence version: 146 DIP protein P35968 original sequence version: 117 DIP protein P35968 original sequence version: 121 59E7C44B05CFEBB3 p15692-4 Vascular endothelial growth factor A VEGF VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein P15692-4 original sequence version: 150 CCE57097DD3779BD kdr-vegfc-1 8 9 unspecified role unspecified role unspecified role unspecified role Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfc-2 4 9 unspecified role unspecified role unspecified role unspecified role Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfc-3 6 9 unspecified role unspecified role prey prey Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role bait bait Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfc-4 2 9 unspecified role unspecified role unspecified role unspecified role Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfa-6 1 11 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfc-5 3 9 unspecified role unspecified role prey prey Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role bait bait Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association kdr-vegfa-8 7 11 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role bait bait Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction kdr-vegfc-6 5 9 unspecified role unspecified role unspecified role unspecified role Region 112-215 Region 112-215 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Immunoglobulin domain 2-3 Region 118-326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction