DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. DIP original experiment: DIP-220909X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. DIP original experiment: DIP-220907X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Rinschen MM., Yu MJ., Wang G., Boja ES., Hoffert JD., Pisitkun T., Knepper MA. DIP original experiment: DIP-220908X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. aqp2_rat Aquaporin-2 Aqp2 ADH water channel Aquaporin-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct protein protein rat Rattus norvegicus (Rat) Rat MWELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGILVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAIIGSLLYNYLLFPSAKSLQERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGSKA DIP protein P34080 original sequence version: 65 DIP protein P34080 original sequence version: 87 q16539-1 Mitogen-activated protein kinase 14 MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A Cytokine suppressive anti-inflammatory drug-binding protein MAP kinase MXI2 MAX-interacting protein 2 Mitogen-activated protein kinase p38 alpha Stress-activated protein kinase 2a protein protein human Homo sapiens Human MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES DIP protein Q16539-1 original sequence version: 169 DIP protein Q16539 original sequence version: 138 DIP protein Q16539 original sequence version: 187 mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR DIP protein P45983 original sequence version: 96 DIP protein P45983 original sequence version: 185 DIP protein P45983 original sequence version: 124 DIP protein P45983 original sequence version: 103 94FB6BE0358B9B60 mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP DIP protein P27361 original sequence version: 171 DIP protein P27361 original sequence version: 101 DIP protein P27361 original sequence version: 124 DIP protein P27361 original sequence version: 129 DIP protein P27361 original sequence version: 143 E6020CE413EC41F7 aqp2-mapk14-1 1 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 241-271 Region 241-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSer261 pSer261 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain in vitro In vitro phosphorylation phosphorylation reaction phosphorylation aqp2-mapk8-1 2 6 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 241-271 Region 241-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSer261 pSer261 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain in vitro In vitro phosphorylation phosphorylation reaction phosphorylation aqp2-mapk3-1 3 7 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 241-271 Region 241-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSer261 pSer261 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain in vitro In vitro phosphorylation phosphorylation reaction phosphorylation