DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. DIP original experiment: DIP-219216X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. DIP original experiment: DIP-219218X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wilton M., Subramaniam R., Elmore J., Felsensteiner C., Coaker G., Desveaux D. DIP original experiment: DIP-219217X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx The type III effector HopF2Pto targets Arabidopsis RIN4 protein to promote Pseudomonas syringae virulence. rin4_arath RPM1-interacting protein 4 RIN4 MJL12_1 At3g25070 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSSRTKPEQVDTVRRSREHMRSREESELKQFGDAGGSSNEAANKRQGRASQNNSYDNKSPLHKNSYDGTGKSRPKPTNLRADESPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSGANVSGSSRTPTHQSSRNPNNTSSCCCFGFGGK DIP protein Q8GYN5 original sequence version: 96 DIP protein Q8GYN5 original sequence version: 68 AB391ECF840AEA09 q88a90_psesm hopF2 PSPTO_0502 hopF protein protein psesm Pseudomonas syringae pv. tomato (strain DC3000) MGNICGTSGSRHVYSPSHTQRITSAPSTSTHVGGDTLTSIHQLSHSQREQFLNMHDPMRVMGLDHDTELFRTTDSRYIKNDKLAGNPQSMASILMHEELRPNRFASHTGAQPHEARAYVPKRIKATDLGVPSLNVMTGSLARDGIRAYDHMSDNQVSVKMRLGDFLERGGKVYADASSVADDGETSQALIVTLPKGQKVPVERV DIP protein Q88A90 original sequence version: 43 98E67CCC8AE61C44 rin4-hopf2-1 1 4 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rin4-hopf2-2 2 4 unspecified role unspecified role bait bait arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 5 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association hopf2-rin4-1 3 4 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 5 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association