DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219213X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions human Homo sapiens Human comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219215X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219209X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219214X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219210X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219211X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao C., Hsiang TY., Kuo RL., Krug RM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao C., Hsiang TY., Kuo RL., Krug RM. DIP original experiment: DIP-219212X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells. ns1_i72a2 Non-structural protein 1 NS NS1A protein protein i72a2 Influenza A virus (strain A/Udorn/307/1972 H3N2) MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILKEESDEALKMTMASTPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGSSNENGRPPLTPKQKRKMARTARSKVRRDKMAD DIP protein P03495 original sequence version: 109 DIP protein P03495 original sequence version: 73 DIP protein P03495 original sequence version: 88 DIP protein P03495 original sequence version: 101 14D0308795627E5E herc5_human E3 ISG15--protein ligase HERC5 HERC5 CEB1 CEBP1 HECT domain and RCC1-like domain-containing protein 5 Cyclin-E-binding protein 1 protein protein human Homo sapiens Human MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGGAGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEELKLESHTSEKELIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFSSPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFHSPPQEALEIFFLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFSKLVQMFKTAVICQLDYWDESAEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHRLNFFVEVCRRYLWKMTVDASENVQCCVIFSHFPFIFNNLSKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG DIP protein Q9UII4 original sequence version: 83 1449C51A58269A6C isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS DIP protein P05161 original sequence version: 130 DIP protein P05161 original sequence version: 142 DIP protein P05161 original sequence version: 155 DIP protein P05161 original sequence version: 96 DIP protein P05161 original sequence version: 141 DIP protein P05161 original sequence version: 168 DIP protein P05161 original sequence version: 150 B6858A15AB0FFFDE isg15-ns-1 2 10 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human covalent binding covalent binding ns-isg15-1 1 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ns-isg15-2 3 10 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ns-herc5-1 6 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RCC domain Region 1-364 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction isg15-ns-2 4 10 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ns-herc5-2 5 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait Region 1-73 Region 1-73 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 74-238 Region 74-238 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction herc5-ns-1 7 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association