DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215944X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215946X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215945X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215943X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. q716h4_bpsfv 1 protein protein bpsfv Shigella phage Sf6 Shigella flexneri bacteriophage VI Bacteriophage SfVI MATEPKAGRPSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETSPMSTLFGK DIP protein Q716H4 original sequence version: 18 1-117 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 1-118 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 1-119 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 1-120 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction