DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215957X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215958X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215960X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215962X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215959X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215961X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Quintela-Fandino M., Arpaia E., Brenner D., Goh T., Yeung FA., Blaser H., Alexandrova R., Lind EF., Tusche MW., Wakeham A., Ohashi PS., Mak TW. DIP original experiment: DIP-215963X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx HUNK suppresses metastasis of basal type breast cancers by disrupting the interaction between PP2A and cofilin-1. hunk_human Hormonally up-regulated neu tumor-associated kinase HUNK MAKV B19 Serine/threonine-protein kinase MAK-V protein protein human Homo sapiens Human MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGNYLIGSRKLGEGSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNCAGILGYSDPFSTQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDKEMNPLPTQLSTGAISFLRSLLEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLHMTEKLGYKNSDVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEASLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKALLKDRKASKSSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDRDDHVEVLSPSHHYRILNSPVSLARRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC DIP protein P57058 original sequence version: 78 87FC85C67D838AA7 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 limk1_human LIM domain kinase 1 LIMK1 LIMK protein protein human Homo sapiens Human MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD DIP protein P53667 original sequence version: 113 9838BEFBE7006447 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 cof1_human Cofilin-1 CFL1 CFL Cofilin, non-muscle isoform 18 kDa phosphoprotein protein protein human Homo sapiens Human MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL DIP protein P23528 original sequence version: 124 DIP protein P23528 original sequence version: 172 589EF8FC1EC13719 ppp2ca-hunk-1 4 11 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cfl1-hunk-1 1 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cfl1-limk1-3 3 10 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association cfl1-ppp2ca-1 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hunk-cfl1-1 2 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ppp2r1a-hunk-1 6 9 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association limk1-hunk-1 5 10 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association