DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253711X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253735X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253721X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253712X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253720X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253725X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253722X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253708X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253733X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253709X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253729X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253715X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253723X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253718X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253717X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253719X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253727X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253714X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253726X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253706X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253731X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253713X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253705X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253724X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253716X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253734X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253710X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253707X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253732X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253730X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Baye LM., Schulz NP., Beck JS., Zhang Q., Slusarski DC., Sheffield VC. DIP original experiment: DIP-253728X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 322E9DD4DD554813 bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA DIP protein Q8K2G4 original sequence version: 52 F7D8C284B04DA15B bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS DIP protein Q8N3I7 original sequence version: 95 DIP protein Q8N3I7 original sequence version: 69 63D67D877FDFD25B tcpb_mouse T-complex protein 1 subunit beta CCT-beta Cct2 Cctb protein protein mouse Mus musculus Mouse MASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAALMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC DIP protein P80314 original sequence version: 100 605744DF068BB192 bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D bbs4_mouse Bardet-Biedl syndrome 4 protein homolog Bbs4 protein protein mouse Mus musculus Mouse MAEVKLGMKTQVPASVESQKPRSKKAPDFPIVEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQCADNLKQVARSLFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLTYIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVYQKAFEHLGNALTYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENARRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKSALAQYQEMEKKVNFLKDNSPLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKTKHRTNSGSKSATLQQPLGSIQALGQAMSSAAAYRKILSGAVGAQLPKPPSLPLEPEPEPTVEASPTEASEQKKEK DIP protein Q8C1Z7 original sequence version: 69 70640E41509F2479 tcpb_human T-complex protein 1 subunit beta CCT2 99D8.1 CCTB CCT-beta protein protein human Homo sapiens Human MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC DIP protein P78371 original sequence version: 101 DIP protein P78371 original sequence version: 107 57F9E1720D84A31F tcpg_human T-complex protein 1 subunit gamma CCT3 CCTG TRIC5 CCT-gamma hTRiC5 protein protein human Homo sapiens Human MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE DIP protein P49368 original sequence version: 109 DIP protein P49368 original sequence version: 147 DIP protein P49368 original sequence version: 117 0A528762EF24F36B pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE DIP protein Q3SYG4 original sequence version: 47 8E333B7680243B7A bbs10_human Bardet-Biedl syndrome 10 protein BBS10 C12orf58 protein protein human Homo sapiens Human MLSSMAAAGSVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRLLEALHLEHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLMCENIQTHGRHWKNCSRWKFISQALLTFQTQILDGIMDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFWIMEKTKAIMKHLHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIGLSPFVPPQAFSQCEIPNTALVKFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQHEDALHGALKMLRQLFKDLDLNYMTQTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDALEKTQTYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLTDYYEPLLKNNSTAYSTRGNRIEISYENLQVTNITRKGSMLPVSCKLPNMGTSQSYLSSSMPAGCVLPVGGNFEILLHYYLLNYAKKCHQSEETMVSMIIANALLGIPKVLYKSKTGKYSFPHTYIRAVHALQTNQPLVSSQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL DIP protein Q8TAM1 original sequence version: 73 558143FFA5F191DD bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS DIP protein Q9CWF6 original sequence version: 63 C91D9B7834B614F4 bbs12_human Bardet-Biedl syndrome 12 protein BBS12 C4orf24 protein protein human Homo sapiens Human MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPDGFQEHVTATHKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQQGNCTKPFMFDISRIFTCCLPGLPETSSCVCPGYITVVSVSNNPVIKELQNQPVRIVLIEGDLTENYRHLGFNKSANIKTVLDSMRLQEDSSEELWANHVLQVLIQFKVNLVLVQGNVSERLIEKCINSKRLVIGSVNGSVMQAFAEAAGAVQVAYITQVNEDCVGDGVCVTFWRSSPLDVVDRNNRIAILLKTEGINLVTAVLTNPVTAQMQIKEDRFWTCAYRLYYALKEEKVFLGGGAVEFLCLSCLHILAEQSLKKENHACSGWLHNTSSWLASSLAIYRPTVLKFLANGWQKYLSTLLYNTANYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFLFL DIP protein Q6ZW61 original sequence version: 58 F441A12526A23B40 mkks_mouse McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin Mkks Bbs6 Protein Bbs6 homolog protein protein mouse Mus musculus Mouse MSRLEAKKPSLCKTEPLTSEKVRSTLSVLKGVIASCYGPSGRLKQLHNGLGGCVYTTSQSSALLRNLSVTHPVLKILTSSVQNHVSCFSDCGLFTAILCCNLIENIQRLDLTPATAIKLNKYLLSLCTSYLKSEACSCRIPVDFRSTHTFLSLVHSILTSKPACMLTRKETDHIGALILKAFLLTIPESTEERMVLGKSIIVPLKGQRVTDSTVLPGLLIEASEVQLRRLLPTQKASGLRVALFCTSLSGDFSNAGEGVVVAHYQVSLENAVLEQLLNLGRRLVTDHVDLVLCQKVIHPSLKQFFSERHVMAIDRVGVTLMESLSKVTGATPIGSLNPIVSTTYGSVKDVCSARFGSKHFFHLLPNEATVCTLLLCSRNDTAWEELKLTCQTAMHVLQLTIKEPWVLLGGGCTETHLAAYVRHKVHHEAEAIVRDDGCTQAKLHVAAEAFCSALESVAGSLEHDGGEILIDTKYGHLWSCQADSASVGNWSDTLSRCGCGLYNSQEELSWSVLRSTYHPFAPQTCLPQAALGSASNLTVDCFTAKLSGLQVAVETANLILDLSYVIEDKN DIP protein Q9JI70 original sequence version: 64 7E2AA28D43028800 tcpd_human T-complex protein 1 subunit delta CCT4 CCTD SRB CCT-delta Stimulator of TAR RNA-binding protein protein human Homo sapiens Human MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR DIP protein P50991 original sequence version: 100 39913C0D0735180D tcpa_human T-complex protein 1 subunit alpha CCTA TCP1 CCT1 CCT-alpha protein protein human Homo sapiens Human MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND DIP protein P17987 original sequence version: 114 DIP protein P17987 original sequence version: 123 486ECA836EA258A1 bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF tcpq_human T-complex protein 1 subunit theta CCT8 CCTQ KIAA0002 CCT-theta Renal carcinoma antigen NY-REN-15 C21orf112 Chaperonin containing T-complex polypeptide 1 subunit 8 protein protein human Homo sapiens Human MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQND DIP protein P50990 original sequence version: 110 566A6622BC2D15E9 mkks_human McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin Bardet-Biedl syndrome 6 protein MKKS BBS6 protein protein human Homo sapiens Human MSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVTHPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRIPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMTGTQPIGSLGSICPNSYGSVKDVCTAKFGSKHFFHLIPNEATICSLLLCNRNDTAWDELKLTCQTALHVLQLTLKEPWALLGGGCTETHLAAYIRHKTHNDPESILKDDECTQTELQLIAEAFCSALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANWPDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTLDCLTAKLSGLQVAVETANLILDLSYVIEDKN DIP protein Q9NPJ1 original sequence version: 122 DIP protein Q9NPJ1 original sequence version: 95 14BA57FF8AEA0AF7 tcpe_human T-complex protein 1 subunit epsilon CCT5 CCTE KIAA0098 CCT-epsilon protein protein human Homo sapiens Human MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE DIP protein P48643 original sequence version: 108 164168BB80EF022A ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML DIP protein Q8VD72 original sequence version: 76 9A8ACDF59BB641C1 ttc8_human Tetratricopeptide repeat protein 8 TTC8 BBS8 Bardet-Biedl syndrome 8 protein protein protein human Homo sapiens Human MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML DIP protein Q8TAM2 original sequence version: 114 DIP protein Q8TAM2 original sequence version: 85 013CFB0FDEBF385B bbs10_mouse Bardet-Biedl syndrome 10 protein homolog Bbs10 protein protein mouse Mus musculus Mouse MASQGSVTAALRVAEVLESIANRCVGPEGGQVLCTKPTGEVLLSRDGGCLLEALHLEHPLARMIVACVSSHLKKTGDGAKTFIIFLCHLLRGLHAIGEKGKDSFTSENIQSHERHWKNCCQWKSISQALQTFQTQTLGCIVDRSLSRHYLSVFSSSTEGRKLCRHSLELLLEAYFCGRVGRNNHRFISQLMCDYVFKCMACESGVEVFELLDHCFAELNVGVTGLPVSDSRIIDGLVLPRDFSMYCPADGDIRMVIVTEILQPQFSSAGSEFVLNSETQFQASQCWITDRTKTVMNHLRGQNVKLLLTSVKQPDLVIYCARLNSISVVECLSAEEVSLVQRITGLSPCVLPEVASQCEISDSTLVKFCKPLILRSKRYVHLGLISTCAFIPHSMVLCGPVLGLVEQHERAFHGAFKMLRQLFTDLDLNYIIQTKQQCNPSPLAYDNSRERNHSPETDKYQDIVAKSKNKLETQTHLEVYSGLGASDTELRAGKPWSAHKKTPIAPSQTDEMLKCLPPERSGIIDNCDLSIENHSTGNPTAEDTGTEISFEHLQVSDNAGKGYTLPVMRKSLDTCTCQGYCSSTVPAGCVLPVGGSFEILMSYYLLSYAKQCRQSDETVISMLIADALLGIPKILYKPKKGKDSFPHIYMRSLHALQASQPMVSGQSGFESVAGKYQLLTSVLQCLMKILTIDLIINIKRQPQKTADQESEDEF DIP protein Q9DBI2 original sequence version: 69 AEEBC611994FDB84 tcpg_mouse T-complex protein 1 subunit gamma CCT-gamma Matricin mTRiC-P5 Cct3 Cctg protein protein mouse Mus musculus Mouse MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAPDAGQE DIP protein P80318 original sequence version: 97 492F9743C607FA1D tcpa_mouse T-complex protein 1 subunit alpha CCT-alpha Tailless complex polypeptide 1B Tcp1 Ccta Cct1 Tailless complex polypeptide 1A protein protein mouse Mus musculus Mouse MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYENAVHSGALDD DIP protein P11983 original sequence version: 108 48F2387BE0F909A4 cct2-cct3-1 31 56 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 36 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 57 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association bbs10-bbs12-1 23 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs2-mkks-1 27 51 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role bait bait Coiled-coil domain Region 325-369 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs9-bbs10-1 11 41 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs12-bbs10-1 20 51 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role prey prey human Homo sapiens Human 44 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association bbs9-bbs10-2 5 41 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role prey prey Q8TAM1:p.Arg49Trp R49W mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R W This feature has been corrected as a result of our quality control procedures. The original label was 'R49W'. Wed May 02 15:56:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg49trp' Tue Jun 30 17:41:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg49Trp' Q8TAM1:p.Asp81Asn D81N mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D81N'. Wed May 02 19:58:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp81asn' Tue Jun 30 18:35:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp81Asn' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs2-bbs7-2 1 49 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role bait bait Region 373-721 Region 373-721 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs5-bbs1-1 25 54 unspecified role unspecified role prey prey human Homo sapiens Human 48 unspecified role unspecified role prey prey human Homo sapiens Human 37 unspecified role unspecified role prey prey human Homo sapiens Human 34 unspecified role unspecified role prey prey human Homo sapiens Human 49 unspecified role unspecified role prey prey human Homo sapiens Human 41 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association mkks-bbs12-2 7 51 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs12-bbs7-3 28 50 unspecified role unspecified role prey prey human Homo sapiens Human 46 unspecified role unspecified role prey prey human Homo sapiens Human 39 unspecified role unspecified role prey prey human Homo sapiens Human 52 unspecified role unspecified role prey prey human Homo sapiens Human 40 unspecified role unspecified role prey prey human Homo sapiens Human 47 unspecified role unspecified role prey prey human Homo sapiens Human 44 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 49 unspecified role unspecified role prey prey human Homo sapiens Human 51 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association bbs9-bbs12-1 26 41 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association cct2-cct3-3 17 56 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 36 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 57 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 45 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association mkks-bbs2-1 2 51 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs12-bbs10-2 3 44 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8TAM1:p.Asp81Asn D81N mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D81N'. Wed May 02 16:27:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp81asn' Tue Jun 30 18:41:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp81Asn' Q8TAM1:p.Ser329Leu S329L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S L This feature has been corrected as a result of our quality control procedures. The original label was 'S329L'. Wed May 02 17:50:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser329leu' Tue Jun 30 16:51:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser329Leu' Q8TAM1:p.Ser311Ala S311A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S311A'. Wed May 02 16:07:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser311ala' Tue Jun 30 15:38:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser311Ala' Q8TAM1:p.Val240Gly V240G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V G This feature has been corrected as a result of our quality control procedures. The original label was 'V240G'. Wed May 02 15:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val240gly' Tue Jun 30 15:45:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val240Gly' human Homo sapiens Human physical association physical association bbs9-bbs1-5 4 49 unspecified role unspecified role prey prey human Homo sapiens Human 48 unspecified role unspecified role prey prey human Homo sapiens Human 34 unspecified role unspecified role prey prey human Homo sapiens Human 37 unspecified role unspecified role prey prey human Homo sapiens Human 41 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association bbs7-bbs1-3 15 35 unspecified role unspecified role prey prey human Homo sapiens Human 54 unspecified role unspecified role prey prey human Homo sapiens Human 48 unspecified role unspecified role prey prey human Homo sapiens Human 37 unspecified role unspecified role prey prey human Homo sapiens Human 34 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role prey prey human Homo sapiens Human 51 unspecified role unspecified role prey prey human Homo sapiens Human 46 unspecified role unspecified role prey prey human Homo sapiens Human 40 unspecified role unspecified role prey prey human Homo sapiens Human 39 unspecified role unspecified role prey prey human Homo sapiens Human 47 unspecified role unspecified role prey prey human Homo sapiens Human 41 unspecified role unspecified role prey prey human Homo sapiens Human 49 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association bbs7-bbs12-1 29 49 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association mkks-bbs12-3 22 51 unspecified role unspecified role bait bait Q9NPJ1:p.Thr57Ala T57A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T57A'. Wed May 02 19:41:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr57ala' Tue Jun 30 16:01:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr57Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs12-bbs10-3 24 51 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 34 unspecified role unspecified role prey prey human Homo sapiens Human 42 unspecified role unspecified role prey prey human Homo sapiens Human 44 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association mkks-bbs12-4 18 51 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Q6ZW61:p.Ile346Thr I346T mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I T This feature has been corrected as a result of our quality control procedures. The original label was 'I346T'. Wed May 02 19:50:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile346thr' Tue Jun 30 17:32:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile346Thr' Q6ZW61:p.Thr501Met T501M mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T M This feature has been corrected as a result of our quality control procedures. The original label was 'T501M'. Wed May 02 18:30:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr501met' Tue Jun 30 16:06:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr501Met' Q6ZW61:p.Gly540Val G540V mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V This feature has been corrected as a result of our quality control procedures. The original label was 'G540V'. Wed May 02 20:16:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly540val' Tue Jun 30 18:11:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly540Val' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs10-bbs12-2 8 40 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 39 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 47 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 49 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 44 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 51 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs9-bbs12-2 9 41 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs12-mkks-1 13 51 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs7-cct2-2 19 40 unspecified role unspecified role prey prey human Homo sapiens Human 39 unspecified role unspecified role prey prey human Homo sapiens Human 47 unspecified role unspecified role prey prey human Homo sapiens Human 49 unspecified role unspecified role bait bait human Homo sapiens Human association association bbs2-bbs12-1 30 34 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs1-bbs12-1 16 37 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs4-mbbs1-1 6 38 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 32 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association bbs7-bbs10-1 14 49 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 42 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8TAM1:p.Asp81Asn D81N mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D81N'. Wed May 02 20:13:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp81asn' Tue Jun 30 16:25:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp81Asn' Q8TAM1:p.Val240Gly V240G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V G This feature has been corrected as a result of our quality control procedures. The original label was 'V240G'. Wed May 02 14:53:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val240gly' Tue Jun 30 17:05:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val240Gly' Q8TAM1:p.Arg34Pro R34P mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R P This feature has been corrected as a result of our quality control procedures. The original label was 'R34P'. Wed May 02 17:01:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg34pro' Tue Jun 30 17:47:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg34Pro' human Homo sapiens Human physical association physical association bbs2-bbs4-3 10 53 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 33 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 38 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 43 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 32 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association bbs4-bbs12-1 21 48 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 44 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association bbs10-cct2-1 12 56 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 36 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 57 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 55 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 45 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association