DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Nature structural & molecular biology 2010 imex curation Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. DIP original experiment: DIP-133975X Nature structural & molecular biology 2010 IMEx Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. Nature structural & molecular biology 2010 imex curation Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamashita M., Kurokawa K., Sato Y., Yamagata A., Mimura H., Yoshikawa A., Sato K., Nakano A., Fukai S. DIP original experiment: DIP-133974X Nature structural & molecular biology 2010 IMEx Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3. sec3_yeast Exocyst complex component SEC3 PSL1 YER008C SEC3 Protein PSL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSSKSPFKRKSHSRETSHDENTSFFHKRTISGSSAHHSRNVSQGAVPSSAPPVSGGNYSHKRNVSRASNSSQTSNFLAEQYERDRKAIINCCFSRPDHKTGEPPNNYITHVRIIEDSKFPSSRPPPDSKLENKKKRLLILSAKPNNAKLIQIHKARENSDGSFQIGRTWQLTELVRVEKDLEISEGFILTMSKKYYWETNSAKERTVFIKSLITLYIQTFEGHVPELVNWDLSLFYLDERSYQRAVITNRPGSVSPIKSPTSNFTTNTTQSVGSVPFSAPTERTRRSETESVNPVSTPASVEYHAGMKSLNKAPYSSNSTLNEVNKRYELEQQQQQEEAELRRLEEQKRLQLQKENEMKRLEEERRIKQEERKRQMELEHQRQLEEEERKRQMELEAKKQMELKRQRQFEEEQRLKKERELLEIQRKQREQETAERLKKEEQEALAKKEEEEKSKRNKVDNESYTQEINGKVDNLLEDLNAVLAEETETTPTMQNGTYVPERSTARAHDQLKKPLNIAKVESLGGSDLNDSISLSDEIAGLNTSNLSGEDQDEKNDLSFEKGDEVRYSNNFEGEAPHVYHEVSIIQEEAPAVSQKLILPEENNESEALIESKEEIKTMENIDDEVLLEILTDINWSIEDDADSMIERIDLRLAETEYLFNQNLLSLQKIGPNIRPYEDKVNDECHRIIPTLSLFLMEMSNFSNDIENVESQDNGLQVESANKKLLWNTLDELLKTVSLDEISLNQLLECPIREKNLPWMENQLNLLLKAFQAIGSDGNEVEYNLREISGLKQRLQFYEKVTKIFLNRIVEEMQKKFSNIRGQDISHDQMIRILTTLLIFSPLILFCKEISQKSYQAIVENWNVSIQPVYMELWTKKISQLQGIDTNDEKMNELSLSQLLNEWDTFRKERKTNDINPVFKNSFSLLTECLQTMRQECIVYQNFVEVFFHISSKHNFEEYIKHFNDPDAPPILLDTVKVMQSDREAAVIETQLVSRIFQPIVTRLSSYFVELVKAEPTVAPALTFYLENEIKSLESSNHEFLLSAVTRMYTQIKQVWSDNVEEQVLHFERISNATTNGEILPGILDLPVGLKNSEDLFQFAKRSMDIKDTDEGYESIELMNSSFRKLSIAATRSITHKEVNSSINPNLSDTAALNNDYMETISLLVNSNWLTEMLSMLNFNKDGIFDTSLQNVKKVFDVEKESYASFLLRDTMPKLTAFVYGVSNIIENTNNVNMTNPSRWAAYSRQNLENILLAYTSHEIETLVKRLHTHMVNDFGYHQENAINNVLCDKLWSCIQGQTVSLYLKLYTVIDKHYRGTNIRFTKNDIISAFEEYKNA 6F0C1BF13A77985E 6F0C1BF13A77985E rho1_yeast GTP-binding protein RHO1 RHO1 YPR165W P9325.3 Rho-type GTPase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL 630B17E9E34CFE75 630B17E9E34CFE75 rho1-sec3-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 1-188 Region 1-188 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-320 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rho1-sec3-2 1 4 unspecified role unspecified role bait bait Region 1-188 Region 1-188 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P06780:p.Val43Ala V43A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V43A'. Wed May 02 16:24:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val43ala' Tue Jun 30 18:08:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val43Ala' P06780:p.Phe44Ala F44A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F44A'. Wed May 02 16:22:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe44ala' Tue Jun 30 17:18:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe44Ala' P06780:p.Gln68Ala Q68A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q68A'. Wed May 02 15:21:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln68ala' Tue Jun 30 19:08:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln68Ala' P06780:p.Tyr71Ala Y71A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y71A'. Wed May 02 15:02:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr71ala' Tue Jun 30 15:37:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr71Ala' P06780:p.Arg73Ala R73A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R73A'. Wed May 02 14:52:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg73ala' Tue Jun 30 18:03:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg73Ala' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role prey prey N-terminal domain Region 1-320 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P33332:p.Leu131Ala L131A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L131A'. Wed May 02 17:52:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu131ala' Tue Jun 30 19:15:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu131Ala' P33332:p.Lys136Ala K136A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K136A'. Wed May 02 16:48:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys136ala' Tue Jun 30 16:07:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys136Ala' P33332:p.Glu199Ala E199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E199A'. Wed May 02 20:25:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu199ala' Tue Jun 30 18:17:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu199Ala' ecolx Escherichia coli direct interaction direct interaction