DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hu JL., Zhou BO., Zhang RR., Zhang KL., Zhou JQ., Xu GL. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hu JL., Zhou BO., Zhang RR., Zhang KL., Zhou JQ., Xu GL. DIP original experiment: DIP-134881X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hu JL., Zhou BO., Zhang RR., Zhang KL., Zhou JQ., Xu GL. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hu JL., Zhou BO., Zhang RR., Zhang KL., Zhou JQ., Xu GL. DIP original experiment: DIP-134882X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The N-terminus of histone H3 is required for de novo DNA methylation in chromatin. wdr5_human WD repeat-containing protein 5 BMP2-induced 3-kb gene protein WDR5 BIG3 protein protein human Homo sapiens Human MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC DIP protein P61964 original sequence version: 35 DIP protein P61964 original sequence version: 131 DIP protein P61964 original sequence version: 83 DIP protein P61964 original sequence version: 84 DIP protein P61964 original sequence version: 87 DIP protein P61964 original sequence version: 116 DIP protein P61964 original sequence version: 130 DIP protein P61964 original sequence version: 113 DIP protein P61964 original sequence version: 112 DIP protein P61964 original sequence version: 99 4BF30914A2250286 dnm3l_mouse DNA (cytosine-5)-methyltransferase 3-like Dnmt3l protein protein mouse Mus musculus Mouse MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL DIP protein Q9CWR8 original sequence version: 93 DIP protein Q9CWR8 original sequence version: 71 6C996D220C6F6D83 h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA h3-dnmt3l-1 1 5 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 4 unspecified role unspecified role prey prey Q9CWR8:p.Asp124Ala D124A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D124A'. Wed May 02 17:31:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp124ala' Tue Jun 30 19:31:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp124Ala' Q9CWR8:p.Ile141Trp I141W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I W This feature has been corrected as a result of our quality control procedures. The original label was 'I141W'. Wed May 02 16:09:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile141trp' Tue Jun 30 18:30:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile141Trp' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range PHD domain Region 87-179 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction h3-wdr5-1 2 3 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro direct interaction direct interaction