DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Feria Bourrellier AB., Valot B., Guillot A., Ambard-Bretteville F., Vidal J., Hodges M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Feria Bourrellier AB., Valot B., Guillot A., Ambard-Bretteville F., Vidal J., Hodges M. DIP original experiment: DIP-215864X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. Proceedings of the National Academy of Sciences of the United States of America 2010 imex curation Feria Bourrellier AB., Valot B., Guillot A., Ambard-Bretteville F., Vidal J., Hodges M. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Feria Bourrellier AB., Valot B., Guillot A., Ambard-Bretteville F., Vidal J., Hodges M. DIP original experiment: DIP-215863X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Chloroplast acetyl-CoA carboxylase activity is 2-oxoglutarate-regulated by interaction of PII with the biotin carboxyl carrier subunit. bccp1_arath Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic BCCP1 CAC1 MQK4.12 At5g16390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSFSVTSPAAAASVYAVTQTSSHFPIQNRSRRVSFRLSAKPKLRFLSKPSRSSYPVVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPELATEESISEFLTQVTTLVKLVDSRDIVELQLKQLDCELVIRKKEALPQPQAPASYVMMQQPNQPSYAQQMAPPAAPAAAAPAPSTPASLPPPSPPTPAKSSLPTVKSPMAGTFYRSPAPGEPPFIKVGDKVQKGQVLCIVEAMKLMNEIESDHTGTVVDIVAEDGKPVSLDTPLFVVQP DIP protein Q42533 original sequence version: 80 glnb_arath Nitrogen regulatory protein P-II homolog GLB1 GLNB1 At4g01900 Protein PII-like T7B11.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASMTKPISITSLGFYSDRKNIAFSDCISICSGFRHSRPSCLDLVTKSPSNNSRVLPVVSAQISSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGAQGGSTERHGGSEFSEDKFVAKVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKAEKMTGDMLSPS DIP protein Q9ZST4 original sequence version: 66 FE740EA66776F157 bccp2_arath Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic BCCP2 T20K14_140 At5g15530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLSVPCVKICALNRRVGSLPGISTQRWQPQPNGISFPSDVSQNHSAFWRLRATTNEVVSNSTPMTNGGYMNGKAKTNVPEPAELSEFMAKVSGLLKLVDSKDIVELELKQLDCEIVIRKKEALQQAVPPAPVYHSMPPVMADFSMPPAQPVALPPSPTPTSTPATAKPTSAPSSSHPPLKSPMAGTFYRSPGPGEPPFVKVGDKVQKGQIVCIIEAMKLMNEIEAEKSGTIMELLAEDGKPVSVDTPLFVIAP DIP protein Q9LLC1 original sequence version: 55 q8vz68_arath F6D8.11 F6D8_11 At1g52670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSCSLGAPKVRIFATNFSRLRCGNLLIPNNQRLFVDQSPMKYLSLRTTLRSVKAIQLSTVPPAETEAIADVKDSDETKSTVVNTHLMPKSSEVEALISEITDSSSIAEFELKLGGFRLYVARKLTDESSPPPQQIQPVVAASATPEGVHTNGSATSSSLAITKTSSSSADRPQTLANKAADQGLVILQSPTVGYFRRSKTIKGKRTPTICKEKDIVKEGQVLCYIEQLGGQIPVESDVSGEIVKILREDGEPVGYNDALITVLPSFPGIKKLQ DIP protein Q8VZ68 original sequence version: 42 nagk_arath Acetylglutamate kinase, chloroplastic NAGK N-acetyl-L-glutamate 5-phosphotransferase NAG kinase T8H10.160 At3g57560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATVTSNASPKSFSFTVSNPFKTLIPNKSPSLCYPTRNKNHHRLGFSIKATVSTPPSIATGNAPSPDYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG DIP protein Q9SCL7 original sequence version: 72 96F2C411A86DF531 q93w03_arath At3g56130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSAALGSLHQTLGSAINSQSEVHSLSGNWSASGNSCVPRWRLSNRNSNYRLVLRAKAAKSSTTTISDGSSDASVSDGKKTVRRITFPKEVEALVHEMCDETEVAVLQLKVGDFEMNLKRKIGAATNPIPVADISPTVAPPIPSEPMNKSASSAPSPSQAKPSSEKVSPFKNTSYGKPAKLAALEASGSTNYVLVTSPAVGKFQRSRTVKGKKQSPSCKEGDAIKEGQVIGYLHQLGTELPVTSDVAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDINIQ DIP protein Q93W03 original sequence version: 41 6BB381AECF4102D1 q8grt9_arath At3g15690 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASCSLGVPKIKISAVDLSRVRSGSLLIPYNQRSLLRQRPVKYLSLKTTFGSVKAVQVSTVPTAETSATIEVKDSKEIKSSRLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLYVARNIADNSSLQPPPTPAVTASNATTESPESNGSASSTSLAISKPASSAADQGLMILQSPKVGFFRRSKTIKGKRLPSSCKEKDQVKEGQILCYIEQLGGQFPIESDVTGEVVKILREDGEPVGYNDALISILPSFPGIKKLQ DIP protein Q8GRT9 original sequence version: 39 glb1-bccp1-1 2 7 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 3 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 5 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 9 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 6 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 8 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli association association glb1-bccp2-1 1 5 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association