DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Nature structural & molecular biology 2010 imex curation Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. DIP original experiment: DIP-133963X Nature structural & molecular biology 2010 IMEx Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Nature structural & molecular biology 2010 imex curation Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. DIP original experiment: DIP-133967X Nature structural & molecular biology 2010 IMEx Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Nature structural & molecular biology 2010 imex curation Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. DIP original experiment: DIP-133965X Nature structural & molecular biology 2010 IMEx Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Nature structural & molecular biology 2010 imex curation Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. DIP original experiment: DIP-133966X Nature structural & molecular biology 2010 IMEx Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. Nature structural & molecular biology 2010 imex curation Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhou Q., Kapoor M., Guo M., Belani R., Xu X., Kiosses WB., Hanan M., Park C., Armour E., Do MH., Nangle LA., Schimmel P., Yang XL. DIP original experiment: DIP-133964X Nature structural & molecular biology 2010 IMEx Orthogonal use of a human tRNA synthetase active site to achieve multifunctionality. sywc_human Tryptophan--tRNA ligase, cytoplasmic WARS1 IFI53 Interferon-induced protein 53 Tryptophanyl-tRNA synthetase WARS WRS protein protein human Homo sapiens Human MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ DIP protein P23381 original sequence version: 79 DIP protein P23381-1 original sequence version: 113 E96344449053A0D0 cadh5_human Cadherin-5 CDH5 Vascular endothelial cadherin 7B4 antigen protein protein human Homo sapiens Human MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFRVTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPREELLY DIP protein P33151 original sequence version: 97 6DBEBFC4DA6899D1 cadh5_bovin Cadherin-5 CDH5 Vascular endothelial cadherin protein protein bovin Bos taurus (Bovine) Bovine MQALVMLLATGATYYLGLLAAAAAAVNPGRPNTPGSLPAHRRQKRDWIWNQMHIDEERNDSLPHYVGKIKSSVDPKKTEYQLRGESAGKVFRVDKNTGDVYALERLDREKISEYHLTALVVDKDSKKNLESPSSFTIKVHDVNDNWPVFTHRVFNASVPEMSGIGTSVIQVTAMDADDPTVADHASVVYQLTKGKENFDIRGSGLIVTMNKHLDRETQDKYEVVVKAEDAQGRRGESGTATVFITLQDVNDNFPIFTQNRYTFSVPEDIRVGSPLGSLFVEDPDEPQNRKTKYSFVQGEYRDTFTIDTDPSHNEGIIKPIKPLDYERIRQYSFTIEATDPTIDLRYLGSTSPKNIARVIINVTDVDEPPIFQQPFYHFQLQENQKKPLIGSVLAKDPDAAQRDIRYSIRRTSDKGQFFGITKKGGIYNDKELDREVYPWYNLTVEAKEVDLSGTPTGKESIVQVHIEVMDENDNAPEFAKPYEPKVCENAPQGKLVVQISATDKDITPRDVKFKFSLSTEDSNFTLIDNHDNTANIIVKYGYFDRERAKVHHLPVLISDNGRPSLTGTSTLHVTVCKCNEHGEFTLCEEAAAQVGISIQALVAIFLCILTFTVITLLIILRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSARHGGAKPPRPALDARPSLYAQVQKPPRQAPGAHAPGEMAAMIGVKKDEADHDGGGPPYDTLHIYGYEGAESIAESLSSLGTDSSDSDIDYDFLNDWGTRFKMLAELYGSDPQEELVY DIP protein Q6URK6 original sequence version: 46 cdh5-wars-1 1 7 unspecified role unspecified role bait bait Extracellular domain Region 48-593 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role prey prey T2-TrpRS subunit Region 94-471 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cdh5-wars-2 4 7 unspecified role unspecified role bait bait Extracellular domain Region 48-593 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range P33151:p.Trp51Ala W51A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W51A'. Wed May 02 15:43:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp51ala' Tue Jun 30 18:17:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp51Ala' P33151:p.Trp49Ala W49A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W49A'. Wed May 02 15:53:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp49ala' Tue Jun 30 18:14:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp49Ala' P33151:p.[Trp49Ala;Trp51Ala] W49A/W51A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W49A/W51A'. Wed May 02 19:48:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp49ala,trp51ala' Tue Jun 30 19:45:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp49Ala;Trp51Ala]' human Homo sapiens Human 6 unspecified role unspecified role prey prey T2-TrpRS subunit Region 94-471 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cdh5-wars-3 3 7 unspecified role unspecified role bait bait Extracellular domain Region 48-593 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey T2-TrpRS subunit Region 94-471 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cdh5-wars-4 5 7 unspecified role unspecified role bait bait Extracellular domain Region 48-593 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fc-tag Fc-tag fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 6 unspecified role unspecified role prey prey T2-TrpRS subunit Region 94-471 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain P23381:p.Ala310Trp A310W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A W This feature has been corrected as a result of our quality control procedures. The original label was 'A310W'. Wed May 02 18:47:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala310trp' Tue Jun 30 15:35:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala310Trp' P23381:p.Gly172Met G172M mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G M This feature has been corrected as a result of our quality control procedures. The original label was 'G172M'. Wed May 02 19:25:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly172met' Tue Jun 30 16:00:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly172Met' P23381:p.Gly161Trp G161W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W This feature has been corrected as a result of our quality control procedures. The original label was 'G161W'. Wed May 02 19:24:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly161trp' Tue Jun 30 20:16:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly161Trp' P23381:p.[Tyr159Ala;Gln194Ala] Y159A/Q194A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y159A/Q194A'. Wed May 02 15:46:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr159ala,gln194ala' Tue Jun 30 16:21:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr159Ala;Gln194Ala]' ecolx Escherichia coli physical association physical association wars-cdh5-1 2 8 unspecified role unspecified role prey prey bovin Bos taurus (Bovine) Bovine 6 unspecified role unspecified role bait bait T2-TrpRS subunit Region 94-471 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association