DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Structure (London, England : 1993) 2009 imex curation Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. DIP original experiment: DIP-132017X Structure (London, England : 1993) 2009 IMEx Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Structure (London, England : 1993) 2009 imex curation Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. DIP original experiment: DIP-132014X Structure (London, England : 1993) 2009 IMEx Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Structure (London, England : 1993) 2009 imex curation Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. DIP original experiment: DIP-132016X Structure (London, England : 1993) 2009 IMEx Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Structure (London, England : 1993) 2009 imex curation Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. DIP original experiment: DIP-132018X Structure (London, England : 1993) 2009 IMEx Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. Structure (London, England : 1993) 2009 imex curation Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Pukala TL., Ruotolo BT., Zhou M., Politis A., Stefanescu R., Leary JA., Robinson CV. DIP original experiment: DIP-132015X Structure (London, England : 1993) 2009 IMEx Subunit architecture of multiprotein assemblies determined using restraints from gas-phase measurements. eif3h_human Eukaryotic translation initiation factor 3 subunit H EIF3S3 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p40 subunit EIF3H protein protein human Homo sapiens Human MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN DIP protein O15372 original sequence version: 74 DIP protein O15372 original sequence version: 89 DIP protein O15372 original sequence version: 118 F3A6EFA0CEF587D0 gln1b_myctu Glutamine synthetase glnA1 Glutamate--ammonia ligase Glutamine synthetase I beta glnA MTCY190.31 MTCY427.01 Rv2220 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAADDMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV 576E30073484136D eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY DIP protein P60228 original sequence version: 120 DIP protein P60228 original sequence version: 60 DIP protein P60228 original sequence version: 76 DIP protein P60228 original sequence version: 111 A5368651DD0DDD0C otca_pyrfu Ornithine carbamoyltransferase, anabolic argF PF0594 protein protein pyrfu Pyrococcus furiosus MVVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIKF 14404FBDC2ECCB95 14404FBDC2ECCB95 eif3k_human Eukaryotic translation initiation factor 3 subunit K MSTP001 PTD001 HSPC029 EIF3K ARG134 EIF3S12 Eukaryotic translation initiation factor 3 subunit 12 eIF-3 p25 eIF-3 p28 Muscle-specific gene M9 protein PLAC-24 protein protein human Homo sapiens Human MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ DIP protein Q9UBQ5 original sequence version: 77 DIP protein Q9UBQ5 original sequence version: 92 DIP protein Q9UBQ5 original sequence version: 125 6B2CBBE8A9D1F28F eif3m_human Eukaryotic translation initiation factor 3 subunit M EIF3M HFLB5 PCID1 PCI domain-containing protein 1 Fetal lung protein B5 GA17 PNAS-125 protein protein human Homo sapiens Human MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT DIP protein Q7L2H7 original sequence version: 33 DIP protein Q7L2H7 original sequence version: 48 DIP protein Q7L2H7 original sequence version: 79 63736CA2B093D794 eif3l_human Eukaryotic translation initiation factor 3 subunit L EIF3L HSPC021 HSPC025 EIF3S6IP Eukaryotic translation initiation factor 3 subunit 6-interacting protein MSTP005 EIF3EIP Eukaryotic translation initiation factor 3 subunit E-interacting protein protein protein human Homo sapiens Human MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP DIP protein Q9Y262 original sequence version: 62 DIP protein Q9Y262 original sequence version: 78 DIP protein Q9Y262-1 original sequence version: 109 ECBD32192D96E3FE eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL DIP protein O00303 original sequence version: 142 DIP protein O00303 original sequence version: 80 DIP protein O00303 original sequence version: 95 DIP protein O00303 original sequence version: 126 8A70FC6E2BF07737 eif3e-eif3k-2 2 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 12 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association oct-1 1 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction eif3k-eif3l-2 5 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 12 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction glutamine synthetase-1 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction eif3f-eif3h-3 3 11 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 13 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association