DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. Nature 2009 imex curation Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. DIP original experiment: DIP-219582X Nature 2009 IMEx The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. Nature 2009 imex curation Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. DIP original experiment: DIP-219581X Nature 2009 IMEx The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. Nature 2009 imex curation Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. DIP original experiment: DIP-219579X Nature 2009 IMEx The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. Nature 2009 imex curation Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. DIP original experiment: DIP-219578X Nature 2009 IMEx The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. The structural basis of tail-anchored membrane protein recognition by Get3. Nature 2009 imex curation Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mateja A., Szlachcic A., Downing ME., Dobosz M., Mariappan M., Hegde RS., Keenan RJ. DIP original experiment: DIP-219580X Nature 2009 IMEx The structural basis of tail-anchored membrane protein recognition by Get3. get3_schpo ATPase get3 get3 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Golgi to ER traffic protein 3 Guided entry of tail-anchored proteins 3 SPAC1142.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNLSDAFGTKFGKDARKVPGFDNLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPGIDEALAFAEILKQIKSMEFDCVIFDTAPTGHTLRFLNFPTVLEKALGKLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCPQCMARRKMQQKYLAQIEELYEDFHVVKVPQVPAEVRGTEALKSFSEMLVKPYVYPTSGKE B0EEEE7019E7F4E8 sc61b_human Protein transport protein Sec61 subunit beta SEC61B protein protein human Homo sapiens Human MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS DIP protein P60468 original sequence version: 100 DIP protein P60468 original sequence version: 80 DIP protein P60468 original sequence version: 77 5FAFF4197A62FA49 get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 F795C359B5A4A461 scget3-sec61b-1 1 7 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait Q12154:p.[Cys285Ser;Cys288Ser] C285S/C288S mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C285S/C288S'. Wed May 02 15:42:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys285ser,cys288ser' Tue Jun 30 18:55:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys285Ser;Cys288Ser]' ecolx Escherichia coli direct interaction direct interaction scget3-1 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction scget3-2 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction spget3-1 5 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction spget3-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction