DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper cd circular dichroism CD CD cd predetermined predetermined participant predetermined Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133270X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133267X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133269X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133265X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133266X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. Nature structural & molecular biology 2009 imex curation Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang J., Dye BT., Rajashankar KR., Kurinov I., Schulman BA. DIP original experiment: DIP-133268X Nature structural & molecular biology 2009 IMEx Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure. q13042-1 Cell division cycle protein 16 homolog CDC16 ANAPC6 Anaphase-promoting complex subunit 6 CDC16 homolog Cyclosome subunit 6 protein protein human Homo sapiens Human MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST DIP protein Q13042-1 original sequence version: 94 DIP protein Q13042 original sequence version: 99 DIP protein Q13042 original sequence version: 133 DIP protein Q13042 original sequence version: 143 DIP protein Q13042 original sequence version: 152 cdc26_human Anaphase-promoting complex subunit CDC26 ANAPC12 Anaphase-promoting complex subunit 12 C9orf17 Cell division cycle protein 26 homolog CDC26 protein protein human Homo sapiens Human MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF DIP protein Q8NHZ8 original sequence version: 68 DIP protein Q8NHZ8 original sequence version: 106 DIP protein Q8NHZ8 original sequence version: 115 DIP protein Q8NHZ8 original sequence version: 123 134970EE68F0142C q6dfi7_xenla cdc16.L cdc16 cdc16-prov XELAEV_18012976mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHALRSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFEKSLKEDLKEPSGEWQMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEKELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETLIPESADGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSWFAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAEKWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTYSAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSDAYIGTEIKDKLRCYDFDVHTMKTLKNIISPPWEEREFDFERQSLDESGIMALETSNLLPKSSDTRSPIEEALEIEMNESDMMLETSMSDHST DIP protein Q6DFI7 original sequence version: 38 8BEC989BCF0C78DF cdc16-cdc26-4 2 7 unspecified role unspecified role unspecified role unspecified role Region 212-539 Region 212-539 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role Region 1-29 Region 1-29 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cdc16-cdc26-5 3 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role prey prey Region 1-29 Region 1-29 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cdc16-cdc26-6 4 7 unspecified role unspecified role unspecified role unspecified role Region 212-539 Region 212-539 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-29 Region 1-29 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cdc16-cdc26-7 6 7 unspecified role unspecified role bait bait Region 212-539 Region 212-539 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role prey prey Region 1-29 Region 1-29 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association cdc16-cdc26-8 1 7 unspecified role unspecified role unspecified role unspecified role Region 212-539 Region 212-539 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role Region 1-29 Region 1-29 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cdc16-cdc26-9 5 7 unspecified role unspecified role unspecified role unspecified role Region 212-539 Region 212-539 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-29 Region 1-29 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction