DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133120X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133125X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133122X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133123X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133121X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133119X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. Nature structural & molecular biology 2009 imex curation Depetris RS., Wu J., Hubbard SR. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Depetris RS., Wu J., Hubbard SR. DIP original experiment: DIP-133124X Nature structural & molecular biology 2009 IMEx Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14. q13322-3 Growth factor receptor-bound protein 10 GRB10 GRBIR KIAA0207 Gamma Beta SV-1 GRB10 adapter protein Insulin receptor-binding protein Grb-IR protein protein human Homo sapiens Human MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL DIP protein Q13322-3 original sequence version: 113 rasn_human GTPase NRas Transforming protein N-Ras NRAS HRAS1 protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM DIP protein P01111 original sequence version: 105 DIP protein P01111 original sequence version: 131 DIP protein P01111 original sequence version: 135 DIP protein P01111 original sequence version: 138 6898D3F6815B1EC7 grb7_mouse Growth factor receptor-bound protein 7 Grb7 GRB7 adapter protein Epidermal growth factor receptor GRB-7 protein protein mouse Mus musculus Mouse MELDLSPTHLSSSPEDVCPTPATPPETPPPPDNPPPGDVKRSQPLPIPSSRKLREEEFQATSLPSIPNPFPELCSPPSQKPILGGSSGARGLLPRDSSRLCVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDESWGLVESHPYLALERGLEDHEFVVEVQEAWPVGGDSRFIFRKNFAKYELFKSPPHTLFPEKMVSSCLDAQTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLHIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLRLSYLGSPPLRSVSDNTLVAMDFSGHAGRVIDNPREALSAAMEEAQAWRKKTNHRLSLPTTCSGSSLSAAIHRTQPWFHGRISREESQRLIGQQGLVDGVFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEDEGCLYFSMDEGQTRFTDLLQLVEFHQLNRGILPCLLRHCCARVAL DIP protein Q03160 original sequence version: 82 Interacts with the cytoplasmic domain of the epidermal growth factor receptor which is then inhibited. The interaction is mediated by the SH2 domain. Also binds to ERBB2 mint CD8C307864703645 grb14_human Growth factor receptor-bound protein 14 GRB14 adapter protein GRB14 protein protein human Homo sapiens Human MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL DIP protein Q14449 original sequence version: 94 00472988650F7C6C p06213-1 Insulin receptor INSR HIR-B protein protein human Homo sapiens Human MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS DIP protein P06213-1 original sequence version: 159 DIP protein P06213-1 original sequence version: 135 grb10-1 6 8 unspecified role unspecified role unspecified role unspecified role Region 106-357 Region 106-357 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q13322-3:p.[Cys145Ser;Cys212Ser;Cys232Ser;Cys331Ser] C331S/C232S/C145S/C212S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C331S/C232S/C145S/C212S'. Wed May 02 14:29:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys145ser,cys212ser,cys232ser,cys331ser' Tue Jun 30 18:08:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys145Ser;Cys212Ser;Cys232Ser;Cys331Ser]' ecolx Escherichia coli direct interaction direct interaction nras-grb7-1 4 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait P01111:p.Gly12Asp G12D mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G12D'. Wed May 02 19:16:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 19:57:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association insr-grb14-1 2 12 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association nras-grb14-1 3 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14449:p.Lys140Ala K140A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K140A'. Wed May 02 17:29:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys140ala' Tue Jun 30 18:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys140Ala' Q14449:p.Lys252Ala K252A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K252A'. Wed May 02 18:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys252ala' Tue Jun 30 17:34:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys252Ala' human Homo sapiens Human 9 unspecified role unspecified role bait bait P01111:p.Gly12Asp G12D mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G12D'. Wed May 02 18:46:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 19:58:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association grb10-2 1 8 unspecified role unspecified role unspecified role unspecified role Region 106-357 Region 106-357 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction insr-grb10-2 7 12 unspecified role unspecified role bait bait crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association nras-grb10-1 5 9 unspecified role unspecified role bait bait P01111:p.Gly12Asp G12D mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G12D'. Wed May 02 15:20:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 17:28:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association