DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Helical extension of the neuronal SNARE complex into the membrane. Helical extension of the neuronal SNARE complex into the membrane. Nature 2009 imex curation Stein A., Weber G., Wahl MC., Jahn R. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stein A., Weber G., Wahl MC., Jahn R. DIP original experiment: DIP-219530X Nature 2009 IMEx Helical extension of the neuronal SNARE complex into the membrane. Helical extension of the neuronal SNARE complex into the membrane. Helical extension of the neuronal SNARE complex into the membrane. Nature 2009 imex curation Stein A., Weber G., Wahl MC., Jahn R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stein A., Weber G., Wahl MC., Jahn R. DIP original experiment: DIP-219531X Nature 2009 IMEx Helical extension of the neuronal SNARE complex into the membrane. Helical extension of the neuronal SNARE complex into the membrane. Helical extension of the neuronal SNARE complex into the membrane. Nature 2009 imex curation Stein A., Weber G., Wahl MC., Jahn R. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stein A., Weber G., Wahl MC., Jahn R. DIP original experiment: DIP-219529X Nature 2009 IMEx Helical extension of the neuronal SNARE complex into the membrane. vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH DIP protein O88384 original sequence version: 97 DIP protein O88384 original sequence version: 87 DIP protein O88384 original sequence version: 92 6827DCAF9650DFC6 stx7_rat Syntaxin-7 Stx7 protein protein rat Rattus norvegicus (Rat) Rat MSYTPGIGGDPAQLAQRISSNIQKITQCSAEIQRTLNQLGTPQDTPELRQQLQQEQQYTNQLAKETDKYIKEFGFLPTTPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFVARVRASSRVSGGFPEDSSKEKNFVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCIIILILVVGIVIIFFIVWGLKG DIP protein O70257 original sequence version: 95 42D23BA7EC5F5F09 stx8_rat Syntaxin-8 Stx8 protein protein rat Rattus norvegicus (Rat) Rat MAPDPWFSTYDSTCQIAQEIAEKIQERNQCERRGEKTPKLTLTIRTLLKNLKVKIDLLKDLLLRAVSTRQITQLEGDRRQNLLDDLVTRERLLLASFKNEGSEPDLIRSSLMSEEAKRGTPNPWLCEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLVDRKSASCGMIMVILLLLVAIVVVAVWPTN DIP protein Q9Z2Q7 original sequence version: 87 p60881-2 Synaptosomal-associated protein 25 Snap25 Snap Super protein Synaptosomal-associated 25 kDa protein SNAP-25a protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881-2 original sequence version: 54 DIP protein P60881-2 original sequence version: 91 DIP protein P60881-2 original sequence version: 121 DIP protein P60881-2 original sequence version: 126 vamp8_rat Vesicle-associated membrane protein 8 Vamp8 Endobrevin protein protein rat Rattus norvegicus (Rat) Rat MEASGSAGNDRVRNLQSEVEGVKNIMTQNVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILILIILFATGTIPT DIP protein Q9WUF4 original sequence version: 76 mint Involved in the targeting and/or fusion of transport vesicles to their target membrane. Involved in the abscission of the midbody during cell division, which leads to completely separate daughter cells. Involved in the homotypic fusion of early and late endosomes. Involved for dense-granule secretion in platelets. Plays a role in regulated enzyme secretion in pancreatic acinar cells D4449EAF44F03672 snap25-stx1a-16 3 9 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 183-288 Region 183-288 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 30-116 Region 30-116 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association stx7-stx8-1 2 10 unspecified role unspecified role unspecified role unspecified role Region 75-100 Region 75-100 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 130-232 Region 130-232 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 136-236 Region 136-236 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role region 159-261 region 159-261 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association snap25-stx1a-27 1 9 unspecified role unspecified role unspecified role unspecified role Region 7-83/141-204 Region 7-83/141-204 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 183-288 Region 183-288 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 30-116 Region 30-116 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction